Tested Applications
Positive ELISA detected in | Recombinant protein |
Recommended dilution
Application | Dilution |
---|---|
Enzyme-linked Immunosorbent Assay (ELISA) | ELISA : |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 3 publications below |
Product Information
28904-1-AP targets SARS-CoV-2 Envelope Protein in WB, IF, ELISA applications and shows reactivity with virus samples.
Tested Reactivity | virus |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30690 Product name: Recombinant virus 2019-nCOV envelope protein protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-75 aa of NC_045512 Sequence: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV Predict reactive species |
Full Name | COVID-19 E Protein |
GenBank Accession Number | NC_045512 |
Gene Symbol | SARS-CoV-2 Envelope Protein |
Gene ID (NCBI) | 43740570 |
RRID | AB_2881232 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P0DTC4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Envelope protein of coronaviruses is a structural protein existing in both monomeric and homopentameric form. It is a minor component of the virus membrane though it is deemed to be important for many stages including virus infection, replication, dissemination and immune response stimulation. Sequence comparison has shown that this protein is identical to the counterparts of specific Bat and Pangolin coronavirus isolates, even though the Sars-CoV-2 sequence seems to possess specific modifications and characteristics with respect to other Sars CoVs(PMID:32596311). The SARS-CoV-2 envelope protein provide a strategy to assess cross-protection against COVID-19 (PMID: 32446902).
Publications
Species | Application | Title |
---|---|---|
iScience TLR2/NF-κB signaling in macrophage/microglia mediated COVID-pain induced by SARS-CoV-2 envelope protein | ||
Front Cell Neurosci The SARS-CoV-2 envelope protein disrupts barrier function in an in vitro human blood-brain barrier model |