• Featured Product
  • KD/KO Validated

A2BP1 Polyclonal antibody

A2BP1 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA
Cat No. 22647-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, IP, RIP, ELISA

FOX1, RBFOX1, HRNBP1, Hexaribonucleotide-binding protein 1, Fox-1 homolog A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNeuro-2a cells, mouse liver, mouse brain
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22647-1-AP targets A2BP1 in WB, IHC, IF-P, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18527

Product name: Recombinant human A2BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-128 aa of BC113691

Sequence: MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSE

Predict reactive species
Full Name ataxin 2-binding protein 1
Calculated Molecular Weight 395 aa, 42 kDa
Observed Molecular Weight 45-70 kDa
GenBank Accession NumberBC113691
Gene Symbol A2BP1
Gene ID (NCBI) 54715
RRIDAB_2879142
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NWB1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

A2BP1, also named as FOX1 and HRNBP1, contains one RRM (RNA recognition motif) domain. A2BP1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. A2BP1 and ataxin-2 are both localized in the trans-Golgi network. This is a rabbit polyclonal antibody raised against the N terminus of human A2BP1.A2BP1 has two mouse isoforms (A2BP1-A016 and -A030) exogenously expressed in COS7 cells showed a molecular mass of 65 kDa, although the calculated molecular masses of A016 and A030 are 40 and 42 kDa, respectively in the course of cell biological study.

Protocols

Product Specific Protocols
IF protocol for A2BP1 antibody 22647-1-APDownload protocol
IHC protocol for A2BP1 antibody 22647-1-APDownload protocol
IP protocol for A2BP1 antibody 22647-1-APDownload protocol
WB protocol for A2BP1 antibody 22647-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,RIP

Mol Ther Oncolytics

RBFOX1 Regulates the Permeability of the Blood-Tumor Barrier via the LINC00673/MAFF Pathway.

Authors - Shuyuan Shen
  • KD Validated
humanIF

MedComm (2020)

Single-cell transcriptomics reveal the remodeling landscape of bladder in patients with obstruction-induced detrusor underactivity

Authors - Jiawei Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Gaurav (Verified Customer) (10-07-2025)

Good antibody that works with various sample types.

  • Applications: Western Blot, Cell culture
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: Rat SMCs, HEK293, A10 cells.
A2BP1 Antibody Western Blot,Cell culture validation (1:3000 dilution) in Rat SMCs, HEK293, A10 cells. (Cat no:22647-1-AP)
FH

Karthik (Verified Customer) (09-03-2025)

Cortical neurons permeabilized with 0.25% triton x for 10 minutes and labeled with 1:250 dilution of RBFOX1 ab for 2 hours at room temperature.

  • Applications: Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Mouse cortical neurons
A2BP1 Antibody Immunofluorescence,Cell culture validation (1:250 dilution) in Mouse cortical neurons (Cat no:22647-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...