Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ABLIM1 Polyclonal antibody

ABLIM1 Polyclonal Antibody for WB, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

ABLIM, abLIM-1, actin binding LIM protein 1, Actin-binding double zinc finger protein, Actin-binding LIM protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ABLIM1 in ?

Tested Applications

Positive WB detected inNCI-H1299 cells, HEK-293 cells, HeLa cells, Y79 cells
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15129-1-AP targets ABLIM1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7258

Product name: Recombinant human ABLIM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 55-401 aa of BC002448

Sequence: DIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF

Predict reactive species
Full Name actin binding LIM protein 1
Calculated Molecular Weight 88 kDa
Observed Molecular Weight 48-52 kDa, 105-110 kDa
GenBank Accession NumberBC002448
Gene Symbol ABLIM1
Gene ID (NCBI) 3983
RRIDAB_2257767
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14639
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABLIM1 (actin-binding LIM protein 1) is a member of the LIM-domain protein family, mediating interactions between actin filaments and cytoplasmic targets. ABLIM1 has been reported as a cell cortex protein specifically in non-erythrocytes, and is critical for the formation of dense interwoven cortical actin meshwork. Due to the alternative splicing, ABLIM1 has multiple isoforms with predicted masses of 52, 70, and 88 kDa, respectively(PMID: 9245787). The phosphorylation or binding with SUMO2 may result in higher MW.

Protocols

Product Specific Protocols
IF protocol for ABLIM1 antibody 15129-1-APDownload protocol
WB protocol for ABLIM1 antibody 15129-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ABLIM1 Polyclonal antibody (Cat# 15129-1-AP) has 9 citations across journals including Nature Cell Biology, Circulation Research, Biomaterials, International Journal of Biological Sciences, Journal of Cellular Physiology, Frontiers in Oncology, Molecular Biology of the Cell, medRxiv, and bioRxiv. Research fields span cilia assembly and actin dynamics, cardiac Z-disc function, osteoarthritis, hepatocellular carcinoma, osteoclastogenesis, uterine smooth muscle tumors, protein spatial organization at zyxin, fibrotic lung disease, and ALS/FTD splicing defects.

SpeciesApplicationTitle
humanWB

Nat Cell Biol

miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.

Authors - Cao Jingli J
  • KD Validated
mouseWB,IF

Circ Res

GSK-3β Localizes to the Cardiac Z-Disc to Maintain Length Dependent Activation

Authors - Marisa J Stachowski-Doll
mouseIF

Biomaterials

Cell-free fat extract attenuates temporomandibular joint osteoarthritis via repressing ATF3-binding chromatin accessibility.

Authors - Dahe Zhang
humanWB

Int J Biol Sci

Rictor promotes cell migration and actin polymerization through regulating ABLIM1 phosphorylation in Hepatocellular Carcinoma.

Authors - Xin Dong
  • KD Validated
mouseWB

J Cell Physiol

Actin binding LIM 1 (abLIM1) negatively controls osteoclastogenesis by regulating cell migration and fusion.

Authors - Haruna Narahara
  • KD Validated

Front Oncol

A four-gene signature identified by integrated transcriptomic analysis for differential diagnosis and prognosis of uterine smooth muscle tumors

Authors - Huiyi Hu

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Joleen Cheah) gave this product a 1-star rating based on Western Blot testing on MDCK GII cells at a 1:1000 dilution. The reviewer reported that ABLIM should appear around 87 kD, but the two prominent bands detected did not correspond to that expected molecular weight — the upper band appeared just above the 100 kD marker and the lower band below the 75 kD marker (using Bio-Rad Precision Plus Protein Standard). The review was posted in May 2019 for lot 00006167.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Joleen (Verified Customer) (05-29-2019)

ABLIM should be around 87kD, but the 2 prominent bands do not come near that molecular weight. The top band is just above the 100kD molecular weight marker and the lower band is below the 75kD molecular weight marker. (BioRad Precision Plus Protein Standard used).

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: MDCK GII
ABLIM1 Antibody Western Blot, validation (1:1000 dilution) in MDCK GII (Cat no:15129-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...