Use Able AI chat for product recommendations

ACVR1 Monoclonal antibody

ACVR1 Monoclonal Antibody for ELISA

Cat No. 60014-1-Ig
Clone No.2G1B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

ELISA

2G1B1, activin A receptor, type I, Activin receptor like kinase 2, Activin receptor type 1, Activin receptor type I

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60014-1-Ig targets ACVR1 in ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1556

Product name: Recombinant human ACVR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 210-509 aa of BC033867

Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Predict reactive species
Full Name activin A receptor, type I
Calculated Molecular Weight 509 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC033867
Gene Symbol ACVR1
Gene ID (NCBI) 90
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ04771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with the type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for the expression of type I receptors. ACVR1 is expressed in many tissues, including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in the ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).

Publications

SpeciesApplicationTitle

CNS Neurosci Ther

Multiple sevoflurane exposures during mid-trimester induce neurotoxicity in the developing brain initiated by 15LO2-Mediated ferroptosis

Authors - Qian Jiang
Loading...
||
New chat

Able

正在加载,请稍候...