ACVR1B Polyclonal antibody

• 

  WB analysis using 10086-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10086-1-AP (ACVR1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10086-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10086-1-AP (ACVR1B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10086-1-AP

  DMSO treated HepG2 cells were subjected to SDS PAGE followed by western blot with 10086-1-AP (ACVR1B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

ACVR1B Polyclonal Antibody for WB, ELISA

Cat No. 10086-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

activin A receptor, type IB, Activin receptor like kinase 4, Activin receptor type 1B, Activin receptor type-1B, Activin receptor-like kinase 4

---

Tested Applications

• Positive WB detected in: HepG2 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

10086-1-AP targets ACVR1B in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0129

  Product name: Recombinant human ACVR1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-448 aa of BC000254

  Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC

• Full Name: activin A receptor, type IB
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC000254
• Gene Symbol: ACVR1B
• Gene ID (NCBI): 91
• RRID: AB_2877723
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36896
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACVR1B (ALK4, activin A receptor type 1B) is a transforming growth factor-beta (TGF-beta) superfamily member (PMID: 37020544). A potential role for ACVR1B in regulating muscle mass is that it is part of the transforming growth factor b (TGFb) pathway regulating myostatin (PMID: 21063444).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC,IF	J Am Heart Assoc; Activin Receptor-Like Kinase 4 Haplodeficiency Mitigates Arrhythmogenic Atrial Remodeling and Vulnerability to Atrial Fibrillation in Cardiac Pathological Hypertrophy.; Authors - Qian Wang
mouse	WB,IF	Mol Cell Endocrinol; ActivinA activates Notch1-Shh signaling to regulate proliferation in C2C12 skeletal muscle cells.; Authors - Li Ma
human	WB	Animals (Basel); Bta-miR-24-3p Controls the Myogenic Differentiation and Proliferation of Fetal, Bovine, Skeletal Muscle-Derived Progenitor Cells by Targeting ACVR1B.; Authors - Xin Hu
human	WB	Reprod Biol Endocrinol; PMID: 29925391; Authors - Cheng Li
	WB	PeerJ; Overexpression of LINC00551 promotes autophagy-dependent ferroptosis of lung adenocarcinoma via upregulating DDIT4 by sponging miR-4328; Authors - Xiong Peng
rat	WB	J Toxicol Sci; Salvianolic acid B attenuated cisplatin-induced cardiac injury and oxidative stress via modulating Nrf2 signal pathway.; Authors - Zhenjian Lin