ADI1 Polyclonal antibody

ADI1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15133-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Aci reductone dioxygenase, acireductone dioxygenase 1, ADI1, APL1, ARD, HMFT1638, MTCBP 1, MTCBP1, SIP L, SIPL

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue, rat colon tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15133-1-AP targets ADI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7274

Product name: Recombinant human ADI1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-179 aa of BC001467

Sequence: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA

Predict reactive species
Full Name acireductone dioxygenase 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC001467
Gene Symbol ADI1
Gene ID (NCBI) 55256
RRIDAB_2305014
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BV57
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADI1(acireductone dioxygenase 1 ) is also named as SIPL, ARD, APL1, HMFT1638, MTCBP-1, FLJ10913, MTCBP1 and belongs to the acireductone dioxygenase (ARD) family. It catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).The downregulation of ADI1 protein expression in human prostate cancer specimens argues that ADI1 potentially inhibits the growth that occurs during prostate cancer progression(PMID:17786183). It has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IHC protocol for ADI1 antibody 15133-1-APDownload protocol
WB protocol for ADI1 antibody 15133-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Cell Biol

Pancreatic tumor cell metastasis is restricted by MT1-MMP binding protein MTCBP-1.

Authors - Li Qiang
humanWB

Oncotarget

Arginine deiminase expressed in vivo, driven by human telomerase reverse transcriptase promoter, displays high hepatoma targeting and oncolytic efficiency.

Authors - Hui Jiang
humanWB

Biochem Biophys Res Commun

Clusterin and Pycr1 alterations associate with strain and model differences in susceptibility to experimental pancreatitis.

Authors - Sapna Iyer
Loading...
||
New chat Able
正在加载,请稍候...