ADI1 Polyclonal antibody

• 

  WB analysis of human testis using 15133-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 15133-1-AP (ADI1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat colon using 15133-1-AP

  rat colon tissue were subjected to SDS PAGE followed by western blot with 15133-1-AP (ADI1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 15133-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 15133-1-AP (ADI1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 15133-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 15133-1-AP (ADI1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human colon cancer using 15133-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 15133-1-AP (ADI1 antibody) at dilution of 1:100 (under 40x lens).

ADI1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15133-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Aci reductone dioxygenase, acireductone dioxygenase 1, ADI1, APL1, ARD, HMFT1638, MTCBP 1, MTCBP1, SIP L, SIPL

---

Tested Applications

• Positive WB detected in: human testis tissue, rat colon tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

15133-1-AP targets ADI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7274

  Product name: Recombinant human ADI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-179 aa of BC001467

  Sequence: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA

• Full Name: acireductone dioxygenase 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC001467
• Gene Symbol: ADI1
• Gene ID (NCBI): 55256
• RRID: AB_2305014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BV57
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADI1(acireductone dioxygenase 1 ) is also named as SIPL, ARD, APL1, HMFT1638, MTCBP-1, FLJ10913, MTCBP1 and belongs to the acireductone dioxygenase (ARD) family. It catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).The downregulation of ADI1 protein expression in human prostate cancer specimens argues that ADI1 potentially inhibits the growth that occurs during prostate cancer progression(PMID:17786183). It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Cell Biol; Pancreatic tumor cell metastasis is restricted by MT1-MMP binding protein MTCBP-1.; Authors - Li Qiang
human	WB	Oncotarget; Arginine deiminase expressed in vivo, driven by human telomerase reverse transcriptase promoter, displays high hepatoma targeting and oncolytic efficiency.; Authors - Hui Jiang
human	WB	Biochem Biophys Res Commun; Clusterin and Pycr1 alterations associate with strain and model differences in susceptibility to experimental pancreatitis.; Authors - Sapna Iyer