• Featured Product
  • KD/KO Validated

ADRB2 Polyclonal antibody

ADRB2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 13096-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

ADRB2, ADRB2R, ADRBR, B2AR, BAR, Beta 2 adrenergic receptor, Beta 2 adrenoceptor, Beta 2 adrenoreceptor, BETA2AR

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, rat heart tissue
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13096-1-AP targets ADRB2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3715

Product name: Recombinant human ADRB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 220-413 aa of BC012481

Sequence: SRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL

Predict reactive species
Full Name adrenergic, beta-2-, receptor, surface
Calculated Molecular Weight46 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC012481
Gene Symbol ADRB2
Gene ID (NCBI) 154
RRIDAB_2225401
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07550
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity and type 2 diabetes. This antibody detects ADRB2 with an apparent molecular weight of 50-55 kDa as has been shown by some researches (PMID: 25348166; 12502786; 29232706; 23984976; 19584355).

Protocols

Product Specific Protocols
WB protocol for ADRB2 antibody 13096-1-APDownload protocol
IHC protocol for ADRB2 antibody 13096-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB,IHC

Drug Des Devel Ther

10-Gingerol Enhances the Effect of Taxol in Triple-Negative Breast Cancer via Targeting ADRB2 Signaling

Authors - Yuqi Liang
  • KD Validated
ratWB,IHC

Proc Natl Acad Sci U S A

Astrocytic β2-adrenergic receptors mediate hippocampal long-term memory consolidation.

Authors - Virginia Gao
mouseWB

Diabetes

Hepatokine ERAP1 Disturbs Skeletal Muscle Insulin Sensitivity via Inhibiting USP33-Mediated ADRB2 Deubiquitination.

Authors - Yuguo Niu
ratWB

Mol Ther Nucleic Acids

Translatome and Transcriptome Profiling of Hypoxic-Induced Rat Cardiomyocytes.

Authors - Zhijie Shen
humanWB,IF

Int J Mol Sci

β-Adrenoceptor Activation in Breast MCF-10A Cells Induces a Pattern of Catecholamine Production Similar to that of Tumorigenic MCF-7 Cells.

Authors - Filipa Amaro

Int J Mol Sci

Relation of Plasma Catecholamine Concentrations and Myocardial Mitochondrial Respiratory Activity in Anesthetized and Mechanically Ventilated, Cardiovascular Healthy Swine

Authors - Nadja Abele

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Elisa (Verified Customer) (04-14-2022)

It didn´t work. I used this antibody costained with a marker for microglia (Iba1) and a marker for neuron (neun). I tried two different protocols of immunofluorescence and one of them was with an antigen retrieval step. In both cases I didn´t have luck in obtaining a good result. You can see in the images that I attached.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: tissue, mouse spinal cord
ADRB2 Antibody Immunofluorescence validation (1:50 dilution) in tissue, mouse spinal cord (Cat no:13096-1-AP)
FH

Tongbin (Verified Customer) (08-25-2020)

This antibody works beautifully in western blots.

  • Applications: Western Blot
  • Cell Tissue Type: Heart
Loading...
||
New chat Able
正在加载,请稍候...