ADRB2 Polyclonal antibody

• 

  WB analysis of mouse heart using 13096-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13096-1-AP (ADRB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 13096-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 13096-1-AP (ADRB2 Antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 13096-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13096-1-AP (ADRB2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 13096-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13096-1-AP (ADRB2 Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

ADRB2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13096-1-AP

Publications(19)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ADRB2, ADRB2R, ADRBR, B2AR, BAR, Beta 2 adrenergic receptor, Beta 2 adrenoceptor, Beta 2 adrenoreceptor, BETA2AR

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 16 publications below
• IHC: See 4 publications below
• IF: See 6 publications below

Product Information

13096-1-AP targets ADRB2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3715

  Product name: Recombinant human ADRB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-413 aa of BC012481

  Sequence: SRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL

• Full Name: adrenergic, beta-2-, receptor, surface
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC012481
• Gene Symbol: ADRB2
• Gene ID (NCBI): 154
• RRID: AB_2225401
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07550
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity and type 2 diabetes. This antibody detects ADRB2 with an apparent molecular weight of 50-55 kDa as has been shown by some researches (PMID: 25348166; 12502786; 29232706; 23984976; 19584355).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC	Drug Des Devel Ther; 10-Gingerol Enhances the Effect of Taxol in Triple-Negative Breast Cancer via Targeting ADRB2 Signaling; Authors - Yuqi Liang ; KD Validated
rat	WB,IHC	Proc Natl Acad Sci U S A; Astrocytic β2-adrenergic receptors mediate hippocampal long-term memory consolidation.; Authors - Virginia Gao
mouse	WB	Diabetes; Hepatokine ERAP1 Disturbs Skeletal Muscle Insulin Sensitivity via Inhibiting USP33-Mediated ADRB2 Deubiquitination.; Authors - Yuguo Niu
rat	WB	Mol Ther Nucleic Acids; Translatome and Transcriptome Profiling of Hypoxic-Induced Rat Cardiomyocytes.; Authors - Zhijie Shen
human	WB,IF	Int J Mol Sci; β-Adrenoceptor Activation in Breast MCF-10A Cells Induces a Pattern of Catecholamine Production Similar to that of Tumorigenic MCF-7 Cells.; Authors - Filipa Amaro
		Int J Mol Sci; Relation of Plasma Catecholamine Concentrations and Myocardial Mitochondrial Respiratory Activity in Anesthetized and Mechanically Ventilated, Cardiovascular Healthy Swine; Authors - Nadja Abele

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Elisa (Verified Customer) (04-14-2022)

It didn´t work. I used this antibody costained with a marker for microglia (Iba1) and a marker for neuron (neun). I tried two different protocols of immunofluorescence and one of them was with an antigen retrieval step. In both cases I didn´t have luck in obtaining a good result. You can see in the images that I attached.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:50
• Cell Tissue Type: tissue, mouse spinal cord

ADRB2 Antibody Immunofluorescence validation (1:50 dilution) in tissue, mouse spinal cord (Cat no:13096-1-AP)

FH

Tongbin (Verified Customer) (08-25-2020)

This antibody works beautifully in western blots.

• Applications: Western Blot
• Cell Tissue Type: Heart