AEBP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AEBP2 Polyclonal antibody (11232-2-AP)

AEBP2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 11232-2-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ChIP, ELISA

Synonyms

Adipocyte enhancer-binding protein 2, AE-binding protein 2, AEBP 2

• 

  WB analysis of human testis using 11232-2-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 11232-2-AP (AEBP2 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 11232-2-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 11232-2-AP (AEBP2 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 11232-2-AP

  IP result of anti-AEBP2 (IP:11232-2-AP, 4ug; Detection:11232-2-AP 1:300) with mouse testis tissue lysate 4800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11232-2-AP targets AEBP2 in WB, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1756

  Product name: Recombinant human AEBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-295 aa of BC015624

  Sequence: MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR

• Full Name: AE binding protein 2
• Calculated Molecular Weight: 33 kDa, 54 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC015624
• Gene Symbol: AEBP2
• Gene ID (NCBI): 121536
• RRID: AB_2225962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZN18
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AEBP2, also named as Zinc finger protein AEBP2 or Adipocyte enhancer-binding protein 2, is a 517 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the AEBP2/jing C2H2-type zinc-finger family. AEBP2 as a DNA-binding transcriptional repressor may interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. It may e playing a role in craniofacial and digital development, as well as development of the central nervous system and gastrointestinal tract.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Dual functions of Tet1 in transcriptional regulation in mouse embryonic stem cells.; Authors - Wu Hao H
human	WB	Mol Cancer; Cell surface CD55 traffics to the nucleus leading to cisplatin resistance and stemness by inducing PRC2 and H3K27 trimethylation on chromatin in ovarian cancer; Authors - Rashmi Bharti
human		PLoS Genet; Alu Elements in ANRIL Non-Coding RNA at Chromosome 9p21 Modulate Atherogenic Cell Functions through Trans-Regulation of Gene Networks.; Authors - Holdt Lesca M LM
mouse	WB,ChIP	Nucleic Acids Res; AEBP2 as a potential targeting protein for Polycomb Repression Complex PRC2.; Authors - Kim Hana H
mouse	WB	PLoS One; Aebp2 as an epigenetic regulator for neural crest cells.; Authors - Kim Hana H