Tested Applications
| Positive WB detected in | HeLa cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human kidney tissue, mouse kidney tissue, mouse stomach tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17984-1-AP targets AIF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12400 Product name: Recombinant human AIF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 259-609 aa of BC111065 Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED Predict reactive species |
| Full Name | apoptosis-inducing factor, mitochondrion-associated, 1 |
| Calculated Molecular Weight | 609 aa, 66 kDa |
| Observed Molecular Weight | 67 kDa, 57 kDa |
| GenBank Accession Number | BC111065 |
| Gene Symbol | AIF |
| Gene ID (NCBI) | 9131 |
| RRID | AB_2224539 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95831 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Apoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID: 25101006).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AIF antibody 17984-1-AP | Download protocol |
| IHC protocol for AIF antibody 17984-1-AP | Download protocol |
| IP protocol for AIF antibody 17984-1-AP | Download protocol |
| WB protocol for AIF antibody 17984-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cell Rep Newly synthesized AIFM1 determines the hypersensitivity of T lymphocytes to STING activation-induced cell apoptosis
| ||
Phytomedicine LC-MS based metabonomics study on protective mechanism of ESWW in cerebral ischemia via CYTC/Apaf-1/NDRG4 pathway | ||
Oxid Med Cell Longev miRNA-27a Transcription Activated by c-Fos Regulates Myocardial Ischemia-Reperfusion Injury by Targeting ATAD3a. | ||
Elife Genome-wide CRISPRi screening identifies OCIAD1 as a prohibitin client and regulatory determinant of mitochondrial Complex III assembly in human cells. | ||
PLoS Pathog GP73 represses host innate immune response to promote virus replication by facilitating MAVS and TRAF6 degradation. | ||
J Med Chem Anticancer Effects of Honokiol via Mitochondrial Dysfunction Are Strongly Enhanced by the Mitochondria-Targeting Carrier Berberine. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ziwei (Verified Customer) (01-04-2026) | works as it should be.
|
Ziwei (Verified Customer) (12-14-2025) | The antibody performs reliably in Western blot analysis.
|
Tom (Verified Customer) (11-13-2020) | HeLa cells permeablisied (0.1% Triton X-100 in PBS) then blocked (1% BSA in PBS). Cells incubated with primary antibody (1:100) for 1 hour, 3xPBS prior to 1 hour incubation with goat anti-rabbit 488 Alexa Fluor secondary antibody.
![]() |
Praveen (Verified Customer) (05-17-2019) | Excellent Antibody
![]() |





















