Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AIF Polyclonal antibody

AIF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17984-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

AIFM1, Apoptosis-inducing factor 1, mitochondrial, EC:1.6.99.-, PDCD8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman kidney tissue, mouse kidney tissue, mouse stomach tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17984-1-AP targets AIF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12400

Product name: Recombinant human AIF protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 259-609 aa of BC111065

Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Predict reactive species
Full Name apoptosis-inducing factor, mitochondrion-associated, 1
Calculated Molecular Weight 609 aa, 66 kDa
Observed Molecular Weight 67 kDa, 57 kDa
GenBank Accession NumberBC111065
Gene Symbol AIF
Gene ID (NCBI) 9131
RRIDAB_2224539
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95831
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID: 25101006).

Protocols

Product Specific Protocols
IF protocol for AIF antibody 17984-1-APDownload protocol
IHC protocol for AIF antibody 17984-1-APDownload protocol
IP protocol for AIF antibody 17984-1-APDownload protocol
WB protocol for AIF antibody 17984-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouse,humanWB

Cell Rep

Newly synthesized AIFM1 determines the hypersensitivity of T lymphocytes to STING activation-induced cell apoptosis

Authors - Wangsheng Ji
  • KD Validated
ratWB

Phytomedicine

LC-MS based metabonomics study on protective mechanism of ESWW in cerebral ischemia via CYTC/Apaf-1/NDRG4 pathway

Authors - Yan Liang
ratWB

Oxid Med Cell Longev

miRNA-27a Transcription Activated by c-Fos Regulates Myocardial Ischemia-Reperfusion Injury by Targeting ATAD3a.

Authors - Yandong Bao
humanWB

Elife

Genome-wide CRISPRi screening identifies OCIAD1 as a prohibitin client and regulatory determinant of mitochondrial Complex III assembly in human cells.

Authors - Maxence Le Vasseur
humanWB

PLoS Pathog

GP73 represses host innate immune response to promote virus replication by facilitating MAVS and TRAF6 degradation.

Authors - Xuewu Zhang
humanWB

J Med Chem

Anticancer Effects of Honokiol via Mitochondrial Dysfunction Are Strongly Enhanced by the Mitochondria-Targeting Carrier Berberine.

Authors - Xiaojia Shi

Reviews

    4.7 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ziwei (Verified Customer) (01-04-2026)

works as it should be.

  • Applications: Western Blot

Ziwei (Verified Customer) (12-14-2025)

The antibody performs reliably in Western blot analysis.

  • Applications: Western Blot

Tom (Verified Customer) (11-13-2020)

HeLa cells permeablisied (0.1% Triton X-100 in PBS) then blocked (1% BSA in PBS). Cells incubated with primary antibody (1:100) for 1 hour, 3xPBS prior to 1 hour incubation with goat anti-rabbit 488 Alexa Fluor secondary antibody.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HeLa
AIF Antibody Immunofluorescence validation (1:100 dilution) in HeLa (Cat no:17984-1-AP)

Praveen (Verified Customer) (05-17-2019)

Excellent Antibody

  • Applications: Western Blot,
  • Cell Tissue Type: AC16
AIF Antibody Western Blot, validation ( dilution) in AC16 (Cat no:17984-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...