AKAP8L Polyclonal antibody

• 

  WB analysis of PC-3 using 10103-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10103-1-AP (AKAP8L Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 10103-1-AP

  Immunofluorescent analysis of HEK-293 cells using 10103-1-AP (AKAP8L antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

AKAP8L Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 10103-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

HA95, A-kinase anchor protein 8-like, AKAP95, AKAP8-like protein, AKAP8 like protein

---

Tested Applications

• Positive WB detected in: PC-3 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below

Product Information

10103-1-AP targets AKAP8L in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0145

  Product name: Recombinant human AKAP8L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-286 aa of BC000713

  Sequence: HSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRLPSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQGGSPDE

• Full Name: A kinase (PRKA) anchor protein 8-like
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC000713
• Gene Symbol: AKAP8L
• Gene ID (NCBI): 26993
• RRID: AB_2258197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULX6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AKAP8L, also named as NAKAP, or NAKAP95, is a 646 amino acid protein, which contains two C2H2 AKAP95-type zinc fingers and belongs to the AKAP95 family. AKAP8L localizes in the nucleus matrix and is expressed in the brain cortex. AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. AKAP8L may be involved in nuclear envelope breakdown and chromatin condensation. It also may regulate the initiation phase of DNA replication when associated with TMPO-beta.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Retrovirology; The role of A-kinase anchoring protein 95-like protein in annealing of tRNALys3 to HIV-1 RNA.; Authors - Li Xing ; KD Validated
human	WB	RNA Biol; hnRNPH1-MTR4 complex-mediated regulation of NEAT1v2 stability is critical for IL8 expression.; Authors - Tanzina Tanu ; KD Validated