Tested Applications
| Positive WB detected in | mouse pancreas tissue, rat pancreas tissue |
| Positive IHC detected in | human pancreas tissue, rat pancreas tissue, human heart tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21391-1-AP targets ALDH1L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16046 Product name: Recombinant human ALDH1L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC103935 Sequence: MVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDS Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member L2 |
| Calculated Molecular Weight | 923 aa, 102 kDa |
| Observed Molecular Weight | 102 kDa, 89 kDa |
| GenBank Accession Number | BC103935 |
| Gene Symbol | ALDH1L2 |
| Gene ID (NCBI) | 160428 |
| RRID | AB_2878854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q3SY69 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ALDH1L2(Aldehyde dehydrogenase family 1 member L2) is also named as mitochondrial 10-FTHFDH, mtFDH and belongs to the aldehyde dehydrogenase family and ALDH1L subfamily. The ALDH1L2 gene has three transcriptional variants with the molecular weight of 102 kDa, 42 kDa and 89 kDa(PMID:19823103). It is a mitochondrial enzyme, a likely source of CO2 production from 10-formyltetrahydrofolate in mitochondria and playing an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell(PMID: 20498374). It also has dehydrogenase/hydrolase activities similar to cytosolic FDH (ALDH1L1). The native ALDH1L2 has been reported to exist as a dimer or tetramer(PMID:7822273).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
| IHC protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
| WB protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-ALDH1L2 antibody (Cat# 21391-1-AP) has 18 citations. These appear in journals including Nature Communications, Molecular Cell, Science Advances, Cell Reports, Molecular Therapy, Free Radical Biology and Medicine, Journal of Biological Chemistry, Cell Death & Differentiation, International Journal of Biological Sciences, Molecular Metabolism, Frontiers in Immunology, International Immunopharmacology, Annals of Clinical and Translational Neurology, Biology Direct, Noise Health, plus preprints (bioRxiv, Research Square). Research fields span mitochondrial one-carbon metabolism, ferroptosis, redox balance, renal fibrosis, cancer, and kidney injury.
| Species | Application | Title |
|---|---|---|
Nat Commun Mitochondrial one-carbon metabolism is required for TGF-β-induced glycine synthesis and fibrotic responses.
| ||
Nat Commun Defective NADPH production in mitochondrial disease complex I causes inflammation and cell death. | ||
Sci Adv G6PD-mediated increase in de novo NADP+ biosynthesis promotes antioxidant defense and tumor metastasis. | ||
Int J Biol Sci Interaction Between the PERK/ATF4 Branch of the Endoplasmic Reticulum Stress and Mitochondrial One-Carbon Metabolism Regulates Neuronal Survival After Intracerebral Hemorrhage | ||
Mol Ther Hypermethylation and downregulation of microRNA219a-2 activates the ALDH1L2/GSH/PAI-1 pathway for fibronectin degradation in renal fibrosis |
Reviews
What customers say
Two reviews were submitted for this antibody. One user reported satisfactory performance in Western blot at 1:1000 on liver, kidney, and hippocampus tissues, giving it a top rating. Another user tested it on HeLa cell lysates at 1/1000 and 1/500 but observed multiple non-specific bands ranging from 40 to 100 kDa, with the expected band appearing at ~89 kDa rather than the predicted 102 kDa, resulting in a low rating. Overall, results appear tissue- and context-dependent, with clean signals in some tissues but notable background in others.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gwenaelle (Verified Customer) (02-10-2026) | l'anticorps anti ALDH1L2 a été testé en western blot au 1/1000 puis au 1/500 sur des extraits protéiques dosés ( dépôt 30 et 40µg/puits) de cellules HeLa. L'anticorps est sale et on observe plusieurs bandes allant de 40 à 100kDa (taille calculée 102kDa, taille observée 89kDa selon la fiche technique).
|
Hua (Verified Customer) (08-26-2019) | Works well.
 |
