Tested Applications
Positive WB detected in | mouse pancreas tissue, rat pancreas tissue |
Positive IHC detected in | human pancreas tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 10 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
21391-1-AP targets ALDH1L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16046 Product name: Recombinant human ALDH1L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC103935 Sequence: MVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDS Predict reactive species |
Full Name | aldehyde dehydrogenase 1 family, member L2 |
Calculated Molecular Weight | 923 aa, 102 kDa |
Observed Molecular Weight | 102 kDa, 89 kDa |
GenBank Accession Number | BC103935 |
Gene Symbol | ALDH1L2 |
Gene ID (NCBI) | 160428 |
RRID | AB_2878854 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q3SY69 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ALDH1L2(Aldehyde dehydrogenase family 1 member L2) is also named as mitochondrial 10-FTHFDH, mtFDH and belongs to the aldehyde dehydrogenase family and ALDH1L subfamily. The ALDH1L2 gene has three transcriptional variants with the molecular weight of 102 kDa, 42 kDa and 89 kDa(PMID:19823103). It is a mitochondrial enzyme, a likely source of CO2 production from 10-formyltetrahydrofolate in mitochondria and playing an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell(PMID: 20498374). It also has dehydrogenase/hydrolase activities similar to cytosolic FDH (ALDH1L1). The native ALDH1L2 has been reported to exist as a dimer or tetramer(PMID:7822273).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
IHC protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
IF protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Adv G6PD-mediated increase in de novo NADP+ biosynthesis promotes antioxidant defense and tumor metastasis. | ||
Nat Commun Defective NADPH production in mitochondrial disease complex I causes inflammation and cell death. | ||
Mol Metab Maternal hyperglycemia induces alterations in hepatic amino acid, glucose and lipid metabolism of neonatal offspring: Multi-omics insights from a diabetic pig model | ||
Free Radic Biol Med Ursodeoxycholic acid protects against cisplatin-induced acute kidney injury and mitochondrial dysfunction through acting on ALDH1L2. | ||
J Biol Chem Acetylation of aldehyde dehydrogenase ALDH1L2 regulates cellular redox balance and the chemosensitivity of colorectal cancer to 5-Fluorouracil |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hua (Verified Customer) (08-26-2019) | Works well.
![]() |