Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, HL-60 cells, HeLa cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13073-1-AP targets ALOX15B in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3741 Product name: Recombinant human ALOX15B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC035217 Sequence: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKW Predict reactive species |
| Full Name | arachidonate 15-lipoxygenase, type B |
| Calculated Molecular Weight | 676 aa, 76 kDa |
| Observed Molecular Weight | 67-76 kDa |
| GenBank Accession Number | BC035217 |
| Gene Symbol | ALOX15B |
| Gene ID (NCBI) | 247 |
| RRID | AB_2227031 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
In humans, there are 6 functional lipoxygenases genes. Two of them encode for arachidonic acid 12-lipoxygenating (ALOX12, ALOX12B) and two for 15-lipoxygenating enzymes (ALOX15, ALOX15B). ALOX15B has been described as the most abundant 15-lipoxygenating enzyme species in human carotid atherosclerotic lesions and to be associated with cerebrovascular symptoms. (PMID:24373925). ALOX15B has 4 isoforms produced by alternative splicing with the MW of 76, 67, 69 and 73 kDa. 13073-1-AP can also recognize the mouse Alox8 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ALOX15B antibody 13073-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ALOX15B Polyclonal antibody (Cat# 13073-1-AP) has 13 citations published in journals including J Adv Res, Redox Biology, Cell Death Discovery, Cell Mol Life Sci, Life Sciences, Nutrition, Exp Cell Res, Theriogenology, Discov Oncol, J Chem Neuroanat, Neuroreport, Lipids Health Dis, and J Agric Food Chem. Research fields span ferroptosis, lipid peroxidation, atherosclerosis, traumatic brain injury, sepsis-associated encephalopathy, hepatocellular carcinoma, cardioprotection, hepatic steatosis, spinal cord injury, and breast cancer.
| Species | Application | Title |
|---|---|---|
J Adv Res Modulation of Macrophage ferroptosis under the guide of infrared thermography promotes the healing of pressure injuries | ||
Redox Biol Excessive SOX8 reprograms energy and iron metabolism to prime hepatocellular carcinoma for ferroptosis | ||
Cell Death Discov Crizotinib and its enantiomer suppress ferroptosis by decreasing PE-O-PUFA content | ||
Lipids Health Dis Lipid peroxidation-induced ferroptosis as a therapeutic target for mitigating neuronal injury and inflammation in sepsis-associated encephalopathy: insights into the hippocampal PEBP-1/15-LOX/GPX4 pathway | ||
J Agric Food Chem β-Caryophyllene Confers Cardioprotection by Scavenging Radicals and Blocking Ferroptosis | ||
Cell Mol Life Sci Aminophylline targets miR-128-3p/Slc7a11 axis to attenuate neuronal ferroptosis after traumatic brain injury |
Reviews
What customers say
Two reviewers shared feedback on this antibody. One used it for Western Blot at 1:500 dilution and reported some non-specific bands, rating it 3 out of 5. Another used it for Immunoprecipitation at 1:2500 on monocytes, noting the antibody showed a slightly different position compared to the marker lane, and rated it 5 out of 5. Overall, the antibody performs well for IP but may show some non-specific signals in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nazek (Verified Customer) (08-07-2025) | some non-specific bands seen in the western blot
 |
Ankush (Verified Customer) (04-23-2024) | The antibody showed slightly different position. please refer to the marker lane
 |
