ANKS1B Polyclonal antibody

• 

  WB analysis of A549 using 24783-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 24783-1-AP (ANKS1B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24783-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24783-1-AP (ANKS1B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 24783-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24783-1-AP (ANKS1B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 24783-1-AP

  IP result of anti-ANKS1B (IP:24783-1-AP, 4ug; Detection:24783-1-AP 1:1000) with HeLa cells lysate 3200ug.

• 

  IHC staining of mouse brain using 24783-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24783-1-AP (ANKS1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24783-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24783-1-AP (ANKS1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 24783-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ANKS1B antibody (24783-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

ANKS1B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 24783-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

AIDA, AIDA 1, Amyloid-beta protein intracellular domain-associated protein 1, ANKS2, Ankyrin repeat and sterile alpha motif domain-containing protein 1B

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, mouse testis tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

24783-1-AP targets ANKS1B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20454

  Product name: Recombinant human ANKS1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 446-510 aa of BC026313

  Sequence: GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

• Full Name: ankyrin repeat and sterile alpha motif domain containing 1B
• Calculated Molecular Weight: 1248 aa, 138 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC026313
• Gene Symbol: ANKS1B
• Gene ID (NCBI): 56899
• RRID: AB_2879720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z6G8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANKS1B also named as AIDA or cajalin 2 is a amino acid protein, which contains 7 ANK repeats, 1 PID domain and 2 SAM domains. ANKS1B localizes in cytoplasm and is highly expressed in brain and testis. ANKS1B exists as many alternatively spliced isoforms. It interacts with AbPP to play a role in brain development. AIDA-1 also interacts with coilin in Cajal bodies to regulate pre-mRNA splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EBioMedicine; Juvenile CLN3 disease is a lysosomal cholesterol storage disorder: similarities with Niemann-Pick type C disease; Authors - Jacinda Chen