Tested Applications
Positive WB detected in | A549 cells, HeLa cells, mouse testis tissue |
Positive IP detected in | HeLa cells |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
24783-1-AP targets ANKS1B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20454 Product name: Recombinant human ANKS1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 446-510 aa of BC026313 Sequence: GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF Predict reactive species |
Full Name | ankyrin repeat and sterile alpha motif domain containing 1B |
Calculated Molecular Weight | 1248 aa, 138 kDa |
Observed Molecular Weight | 65-70 kDa |
GenBank Accession Number | BC026313 |
Gene Symbol | ANKS1B |
Gene ID (NCBI) | 56899 |
RRID | AB_2879720 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q7Z6G8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ANKS1B also named as AIDA or cajalin 2 is a amino acid protein, which contains 7 ANK repeats, 1 PID domain and 2 SAM domains. ANKS1B localizes in cytoplasm and is highly expressed in brain and testis. ANKS1B exists as many alternatively spliced isoforms. It interacts with AbPP to play a role in brain development. AIDA-1 also interacts with coilin in Cajal bodies to regulate pre-mRNA splicing.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ANKS1B antibody 24783-1-AP | Download protocol |
IHC protocol for ANKS1B antibody 24783-1-AP | Download protocol |
IF protocol for ANKS1B antibody 24783-1-AP | Download protocol |
IP protocol for ANKS1B antibody 24783-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |