Tested Applications
| Positive WB detected in | UV treated HeLa cells, C6 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells, UV treated NIH/3T3 cells, HepG2 cells |
| Positive IHC detected in | human lung squamous cell cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
| Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24909-1-AP targets JUN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, hamster samples.
| Tested Reactivity | human, mouse, hamster |
| Cited Reactivity | human, mouse, rat, chicken, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17639 Product name: Recombinant human JUN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 92-227 aa of BC068522 Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE Predict reactive species |
| Full Name | jun oncogene |
| Calculated Molecular Weight | 331 aa, 36 kDa |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC068522 |
| Gene Symbol | JUN |
| Gene ID (NCBI) | 3725 |
| RRID | AB_2860574 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05412 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
JUN is also named as c-Jun and AP1, belongs to the bZIP family and Jun subfamily. JUN, the most extensively studied protein of the activator protein-1 (AP-1) complex, is involved in numerous cell activities, such as proliferation, apoptosis, survival, tumorigenesis and tissue morphogenesis[PMID: 22180088]. JUN is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. JUN is a basic leucine zipper (bZIP) transcription factor that acts as homo- or heterodimer, binding to DNA and regulating gene transcription[PMID: 9732876]. In additon, extracellular signals can induce post-translational modifications of JUN, resulting in altered transcriptional activity and target gene expression[PMID:8464713]. More over, it has uncovered multiple layers of a complex regulatory scheme in which JUN is able to crosstalk, amplify and integrate different signals for tissue development and disease. Jun is predominantly nuclear, ubiquitinated Jun colocalizes with lysosomal proteins[PMID: 15469925]. This antibody is a rabbit polyclonal antibody raised against a region of human JUN. Both phosphorylated (p-c-Jun) and unphosphorylated forms of c-Jun, with sizes of 42-45 kDa and 36-39 kDa, respectively are obtain in some experiments. (PMID: 17210646)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for JUN antibody 24909-1-AP | Download protocol |
| IF protocol for JUN antibody 24909-1-AP | Download protocol |
| IHC protocol for JUN antibody 24909-1-AP | Download protocol |
| WB protocol for JUN antibody 24909-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-JUN antibody (Cat# 24909-1-AP) has accumulated 159 citations published in journals including Nature, Cell Metabolism, Nature Communications, Cell Reports Medicine, Journal of Clinical Investigation, Advanced Science, Biomaterials, Cancer Letters, International Journal of Biological Sciences, and many others. Associated research fields span oncology, inflammation, fibrosis, ferroptosis, bone metabolism, liver disease, cardiovascular disease, neuroscience, immunology, and metabolic disorders.
| Species | Application | Title |
|---|---|---|
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.
| ||
Bioact Mater Mantis shrimp saddle-mimetic amorphous calcium (zinc) phosphate/chitin scaffolds with superior mechanical properties and bioactivity for bone regeneration. | ||
Cell Host Microbe Veillonella intestinal colonization promotes C. difficile infection in Crohn's disease | ||
Cancer Res ANO1 reprograms cholesterol metabolism and the tumor microenvironment to promote cancer metastasis | ||
