AP1M1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AP1M1 Polyclonal antibody (12112-1-AP)

• Featured Product
• KD/KO Validated

AP1M1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 12112-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

AP 1 complex subunit mu 1, AP mu chain family member mu1A, AP1M1, AP47, CLAPM2, CLTNM, MU 1A, Mu adaptin 1, Mu1A adaptin

• 

  WB analysis of human brain using 12112-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12112-1-AP (AP1M1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Hacat cells using 12112-1-AP

  WB resut of AP1M1 antibody (12112-1-AP, 1:500) with siRNA cell lysate.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 12112-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 12112-1-AP (AP1M1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 12112-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12112-1-AP (AP1M1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SH-SY5Y using 12112-1-AP

  IP result of anti-AP1M1 (IP:12112-1-AP, 4ug; Detection:12112-1-AP 1:500) with SH-SY5Y cells lysate 2500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AP1M1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, Hacat cells
• Positive IP detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12112-1-AP targets AP1M1 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2757

  Product name: Recombinant human AP1M1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 164-423 aa of BC017469

  Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ

• Full Name: adaptor-related protein complex 1, mu 1 subunit
• Calculated Molecular Weight: 423 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC017469
• Gene Symbol: AP1M1
• Gene ID (NCBI): 8907
• RRID: AB_2058339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXS5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.

Publications

What published studies show

Anti-AP-1 (AP1M1) antibody, catalog number 12112-1-AP, has 15 citations published in journals including Nature, Nature Cell Biology, Nature Communications, Journal of Biological Chemistry, Cell Communication & Signaling, Cell Molecular Life Sciences, International Journal of Molecular Sciences, Biomedical Pharmacotherapy, PLoS ONE, Traffic, Virology, and Cell Chemical Biology. Research fields span STING signaling, autophagy, Golgi–endosome transport, EGFR internalization in lung cancer, Alzheimer's disease, secretory granule biogenesis, vesicle trafficking, and HIV-1 pathogenesis.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Clathrin-associated AP-1 controls termination of STING signalling; Authors - Ying Liu
human	WB	Nat Cell Biol; Plasma membrane contributes to the formation of pre-autophagosomal structures.; Authors - Ravikumar Brinda B ; KD Validated
		Nat Commun; Reversible control of post-Golgi transport by brefeldin A reveals recycling endosome maturation during glycosylphosphatidylinositol-anchored protein transport.; Authors - Arata Takiguchi
mouse	WB	Nat Commun; A CRISPR/Cas9 screen reveals proteins at the endosome-Golgi interface that modulate cellular anti-sense oligonucleotide activity.; Authors - Liza Malong
human	WB	Cell Commun Signal; Crosstalk between KDEL receptor and EGF receptor mediates cell proliferation and migration via STAT3 signaling; Authors - Jie Jia
mouse	WB	Cell Mol Life Sci; ELAPOR1 mediated vesicle traffic is required for acrosome biogenesis and male fertility in mice.; Authors - Runze Ding