AP1M1 Polyclonal antibody

• 

  WB analysis of human brain using 12112-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12112-1-AP (AP1M1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Hacat cells using 12112-1-AP

  WB resut of AP1M1 antibody (12112-1-AP, 1:500) with siRNA cell lysate.

• 

  WB analysis of SH-SY5Y using 12112-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 12112-1-AP (AP1M1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 12112-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12112-1-AP (AP1M1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SH-SY5Y using 12112-1-AP

  IP result of anti-AP1M1 (IP:12112-1-AP, 4ug; Detection:12112-1-AP 1:500) with SH-SY5Y cells lysate 2500ug.

• Featured Product
• KD/KO Validated

AP1M1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 12112-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

AP 1 complex subunit mu 1, AP mu chain family member mu1A, AP1M1, AP47, CLAPM2, CLTNM, MU 1A, Mu adaptin 1, Mu1A adaptin

---

Tested Applications

• Positive WB detected in: human brain tissue, Hacat cells
• Positive IP detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 9 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

12112-1-AP targets AP1M1 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2757

  Product name: Recombinant human AP1M1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 164-423 aa of BC017469

  Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ

• Full Name: adaptor-related protein complex 1, mu 1 subunit
• Calculated Molecular Weight: 423 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC017469
• Gene Symbol: AP1M1
• Gene ID (NCBI): 8907
• RRID: AB_2058339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXS5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Plasma membrane contributes to the formation of pre-autophagosomal structures.; Authors - Ravikumar Brinda B ; KD Validated
human	IF,CoIP	Int J Mol Sci; Leucine Zipper Downregulated in Cancer-1 Interacts with Clathrin Adaptors to Control Epidermal Growth Factor Receptor (EGFR) Internalization and Gefitinib Response in EGFR-Mutated Non-Small Cell Lung Cancer; Authors - Hsien-Neng Huang
human	WB,IF	Traffic; AP-1A controls secretory granule biogenesis and trafficking of membrane secretory granule proteins.; Authors - Mathilde Bonnemaison ; KD Validated
	WB	J Biol Chem; Adaptor Protein-1 Complex Affects the Endocytic Trafficking and Function of Peptidylglycine α-Amidating Monooxygenase, a Luminal Cuproenzyme.; Authors - Mathilde L Bonnemaison ; KD Validated
human,mouse	WB	Biomed Pharmacother; Dioscin alleviates Alzheimer's disease through regulating RAGE/NOX4 mediated oxidative stress and inflammation.; Authors - Linshu Guan
	WB	J Biol Chem; Clathrin adaptor AP-1-mediated Golgi export of amyloid precursor protein is crucial for the production of neurotoxic amyloid fragments.; Authors - Yunan C Januário