Alpha Adaptin Polyclonal antibody

Alpha Adaptin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11401-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

AP2A1, Alpha1 adaptin, Alpha adaptin A, ADTAA, Adaptor-related protein complex 2 subunit alpha-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, human heart tissue, human spleen tissue
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11401-1-AP targets Alpha Adaptin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1927

Product name: Recombinant human AP2A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 677-982 aa of BC014214

Sequence: GAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNPGDREDTRVWGMPGTFLRPFVFLFLFICCCLHSGGLGGVPLPPFPPQAQRGEGPGKWMSPPLPPHPVVAPPTPSPSRGCVLL

Predict reactive species
Full Name adaptor-related protein complex 2, alpha 1 subunit
Calculated Molecular Weight 977 aa, 108 kDa
Observed Molecular Weight 108 kDa
GenBank Accession NumberBC014214
Gene Symbol AP2A1
Gene ID (NCBI) 160
RRIDAB_2056316
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95782
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP2A1 encodes adaptor protein complex 2 (AP-2) subunit alpha-1, which is a 100 kDa coated vesicle protein. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is involved in clathrin-dependent endocytosis.

Protocols

Product Specific Protocols
IF protocol for Alpha Adaptin antibody 11401-1-APDownload protocol
IHC protocol for Alpha Adaptin antibody 11401-1-APDownload protocol
WB protocol for Alpha Adaptin antibody 11401-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Molecular identification of a BAR domain-containing coat complex for endosomal recycling of transmembrane proteins.

Authors - Boris Simonetti

Cell Res

Numb regulates vesicular docking for homotypic fusion of early endosomes via membrane recruitment of Mon1b.

Authors - Ximing Shao
humanWB

Cells

Five Inhibitory Receptors Display Distinct Vesicular Distributions in Murine T Cells

Authors - Jiahe Lu
humanWB

J Immunol

The AP-2 Clathrin Adaptor Mediates Endocytosis of an Inhibitory Killer Cell Ig-like Receptor in Human NK Cells.

Authors - Amanda K Purdy
humanWB

Neurobiol Dis

Sequential screening nominates the Parkinson's disease associated kinase LRRK2 as a regulator of Clathrin-mediated endocytosis.

Authors - George R Heaton
IF

Inflammopharmacology

Ginsenoside compound-K inhibits the activity of B cells through inducing IgD-B cell receptor endocytosis in mice with collagen-induced arthritis.

Authors - Mei Zhang
Loading...
||
New chat Able
正在加载,请稍候...