AP3S2 Polyclonal antibody

AP3S2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15319-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

AP 3 complex subunit sigma 2, AP 3 complex subunit sigma 3B, AP3S2, AP3S3, Sigma 3B adaptin, Sigma adaptin 3b, sigma3b, Sigma3B adaptin

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, human testis tissue, mouse ovary tissue, mouse testis tissue, rat liver tissue
Positive IHC detected inhuman colon cancer tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15319-1-AP targets AP3S2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7565

Product name: Recombinant human AP3S2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-193 aa of BC002785

Sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV

Predict reactive species
Full Name adaptor-related protein complex 3, sigma 2 subunit
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC002785
Gene Symbol AP3S2
Gene ID (NCBI) 10239
RRIDAB_2056644
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP59780
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP3S2 is a 22-kDa protein that belongs to the adaptor complexes small subunit family. AP3S2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-3 complex is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2).

Protocols

Product Specific Protocols
WB protocol for AP3S2 antibody 15319-1-APDownload protocol
IHC protocol for AP3S2 antibody 15319-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...