androgen receptor Polyclonal antibody

androgen receptor Polyclonal Antibody for ELISA
Cat No. 22576-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, pig

Applications

WB, IF, IHC, ELISA

AIS, androgen receptor, AR, DHTR, Dihydrotestosterone receptor, HUMARA, HYSP1, KD, NR3C4, SBMA, SMAX1, TFM

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

22576-1-AP targets androgen receptor in WB, IF, IHC, ELISA applications and shows reactivity with human, monkey, pig samples.

Tested Reactivity human, monkey, pig
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17385

Product name: Recombinant human AR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 615-914 aa of BC132975

Sequence: YEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ

Predict reactive species
Full Name androgen receptor
Calculated Molecular Weight 914 aa, 99 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC132975
Gene Symbol AR
Gene ID (NCBI) 367
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10275
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Androgen receptor (AR) also konwn as Dihydrotestosterone receptor (DHTR), Nuclear receptor subfamily 3 group C member 4 (NR3C4).It is one of steriod hormoen receptors, which are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.Defects in AR are the cause of androgen insensitivity syndrome (AIS).Affected males have female external genitalia, female breast development, blind vagina, absent uterus and female adnexa, and abdominal or inguinal testes, despite a normal 46,XY karyotype.Defects in AR are the cause of spinal and bulbar muscular atrophy X-linked type 1 (SMAX1). In SMAX1 patients the number of Gln ranges from 38 to 62. Longer expansions result in earlier onset and more severe clinical manifestations of the disease.Defects in AR may play a role in metastatic prostate cancer. The mutated receptor stimulates prostate growth and metastases development despite of androgen ablation. This treatment can reduce primary and metastatic lesions probably by inducing apoptosis of tumor cells when they express the wild-type receptor.Defects in AR are the cause of androgen insensitivity syndrome partial (PAIS). PAIS is characterized by hypospadias, hypogonadism, gynecomastia, genital ambiguity, normal XY karyotype, and a pedigree pattern consistent with X-linked recessive inheritance. Some patients present azoospermia or severe oligospermia without other clinical manifestations.This antibody is a rabbit polyclonal antibody. It can specifically recognize the 110kd AR protein.

Publications

SpeciesApplicationTitle
humanWB

Med Oncol

α-Viniferin activates autophagic apoptosis and cell death by reducing glucocorticoid receptor expression in castration-resistant prostate cancer cells.

Authors - Kejun Cheng
humanWB,IHC,IF

Mol Med Rep

HepaCAM inhibits cell proliferation and invasion in prostate cancer by suppressing nuclear translocation of the androgen receptor via its cytoplasmic domain.

Authors - Qingfu Deng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Parmveer (Verified Customer) (12-02-2019)

Did not stain nuclear AR

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Prostate
androgen receptor Antibody Immunofluorescence, validation (1:100 dilution) in Prostate (Cat no:22576-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...