Use Able AI chat for product recommendations

ARCN1 Polyclonal antibody

ARCN1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

COPD, Delta COP, Delta coat protein, Coatomer subunit delta, archain 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ARCN1 in ?

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, A549 cells, Jurkat cells, mouse pancreas tissue, rat pancreas tissue
Positive IHC detected inhuman testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23843-1-AP targets ARCN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20836

Product name: Recombinant human ARCN1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 164-511 aa of BC093636

Sequence: KELQQARRDAERQGKKAPGFGGFGSSAVSGGSTAAMITETIIETDKPKVAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL

Predict reactive species
Full Name archain 1
Calculated Molecular Weight 511 aa, 57 kDa
Observed Molecular Weight 57 kDa, 47 kDa
GenBank Accession NumberBC093636
Gene Symbol ARCN1
Gene ID (NCBI) 372
RRIDAB_2879337
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48444
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Archain 1 (ARCN1), also known as delta-COP, is a subunit of the coat protein I (COPI) complex, which comprises one of the protein coats that mediate vesicle budding from the membrane. Protein sequences of ARCN1 are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking. The gene of ARCN1 has been identified in chromosome band 11q23.3, and sequencing of cDNAs suggests that at least two forms of mRNA with alternative 5' ends are present. (PMID: 7782067; 20502676)

Protocols

Product Specific Protocols
IF protocol for ARCN1 antibody 23843-1-APDownload protocol
IHC protocol for ARCN1 antibody 23843-1-APDownload protocol
WB protocol for ARCN1 antibody 23843-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ARCN1 Polyclonal antibody (Cat# 23843-1-AP) has 5 citations published in Nature, Nature Chemical Biology, Science Advances, Veterinary Research, and bioRxiv. The associated research fields include neuroscience (cortical organoid development and SARS-CoV-2 tropism in astrocytes), cancer biology (colorectal cancer targeting), virology (HPV entry mechanisms), and veterinary infectious disease (Mycoplasma bovis-induced inflammatory responses). Applications cited include IHC, WB, and IF.

SpeciesApplicationTitle
humanIHC

Nature

Cell stress in cortical organoids impairs molecular subtype specification.

Authors - Aparna Bhaduri
humanWB

Nat Chem Biol

Targeting colorectal cancer with small-molecule inhibitors of ALDH1B1.

Authors - Zhiping Feng
humanWB

Sci Adv

HPV is a cargo for the COPI sorting complex during virus entry

Authors - Mara C Harwood
WB

Vet Res

Comprehensive multiomic analysis of extracellular vesicles from Mycoplasma bovis-infected bovine mammary epithelial cells identifies proteins and miRNAs that induce inflammatory responses in macrophages

Authors - Yiming Wu
humanIF

bioRxiv

Tropism of SARS-CoV-2 for Developing Human Cortical Astrocytes.

Authors - Madeline G Andrews

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The only review for this product is from a user named Boyan Zhang (May 2021), who rated it 5 out of 5 stars. The reviewer used the antibody (lot 00018632) for Western Blot and commented that it was "very good for WB detection." Overall, the feedback is positive, highlighting reliable performance in Western Blot applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Boyan (Verified Customer) (05-14-2021)

very good for WB detection

  • Applications: Western Blot
Loading...
||
New chat

Able™

正在加载,请稍候...