Use Able AI chat for product recommendations

Arginase-1 Polyclonal antibody

Arginase-1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

ARG1, Arginase 1, liver Arginase, ARG 1, Arg-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Arginase-1 in ?

Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman liver cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue, human liver cancer tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16001-1-AP targets Arginase-1 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8595

Product name: Recombinant human ARG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-236 aa of BC005321

Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Predict reactive species
Full Name arginase, liver
Calculated Molecular Weight236aa,25 kDa; 322aa,35 kDa
Observed Molecular Weight 35-36 kDa
GenBank Accession NumberBC005321
Gene Symbol Arginase-1
Gene ID (NCBI) 383
RRIDAB_2289842
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05089
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation and ARG1 has been shown to protect motor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins (PMID: 20071539, PMID:12098359). It can exist as a homotrimer and has 3 isoforms produced by alternative splicing (PMID:16141327). Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control (PMID:27117406). ARG1 is mainly expresses in neurons in a normal brain. The expression of ARG1 increases in microglia/macrophages and astrocytes early after CNS injuries. ARG1 has been regarded as a marker for beneficial microglia/macrophages and possesses anti-inflammatory and tissue repair properties under various pathological conditions (PMID: 26538310, PMID: 31619589).

Protocols

Product Specific Protocols
IF protocol for Arginase-1 antibody 16001-1-APDownload protocol
IHC protocol for Arginase-1 antibody 16001-1-APDownload protocol
IP protocol for Arginase-1 antibody 16001-1-APDownload protocol
WB protocol for Arginase-1 antibody 16001-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Arginase-1 (ARG1) polyclonal antibody (Cat# 16001-1-AP) has accumulated 938 citations across high-impact journals including Nature, Cell, Cancer Cell, Nat Commun, Sci Transl Med, Theranostics, Biomaterials, ACS Nano, J Control Release, Phytomedicine, and J Neuroinflammation. Cited research spans macrophage/microglia polarization, tumor immunotherapy, wound healing, bone regeneration, spinal cord injury, neuroinflammation, fibrosis, ferroptosis, atherosclerosis, and diabetic complications, with applications primarily in WB, IF, and IHC.

SpeciesApplicationTitle
mouseWB

Cancer Cell

Distinct roles of TREM2 in central nervous system cancers and peripheral cancers

Authors - Jian Zhong
mouseWB

Nature

Spermine is an endogenous iron chelator that inhibits ferroptosis

Authors - Man Li
humanIF

Cancer Cell

Pan-cancer human brain metastases atlas at single-cell resolution

Authors - Xudong Xing

Cell

Dietary arginine drives codon-dependent MHC class I translation and improves immunity in colon tumorigenesis and respiratory viral infection.

Authors - Qiushuang Wu
humanIHC

Mol Cancer

Integrating single cell- and spatial- resolved transcriptomics unravels the inter-tumor heterogeneity and immunosuppressive landscape in HBV- and Clonorchis sinensis-associated hepatocellular carcinoma.

Authors - Jiayun Chen
mouseWB

Adv Mater

Suppression of Sepsis Cytokine Storm by Escherichia Coli Cell Wall-Derived Carbon Dots

Authors - Yinan Li

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 16001-1-AP is from a researcher who used it for immunofluorescence on human skin biopsy at a 1:50 dilution. They rated it 5 stars and noted that the antibody performs very well for immunohistochemistry from human skin samples. Overall, the feedback is positive, highlighting strong performance in tissue-based applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Debanjan (Verified Customer) (12-23-2019)

This antibody performs very well for immunohistochemistry from human skin samples

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Human skin Biopsy
Arginase-1 Antibody Immunofluorescence, validation (1:50 dilution) in Human skin Biopsy (Cat no:16001-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...