Arrestin C Polyclonal antibody

• 

  WB analysis using 11100-2-AP

  Mouse eye tissues were subjected to SDS PAGE followed by western blot with 11100-2-AP (Arrestin C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11100-2-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11100-2-AP (Arrestin C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse eye using 11100-2-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 11100-2-AP (Arrestin C antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 11100-2-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11100-2-AP (Arrestin C antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of rat eye using 11100-2-AP

  Immunofluorescent analysis of (-20°C Acetone) fixed paraffin-embedded rat eye tissue using Arrestin C antibody (11100-2-AP) at dilution of 1:600 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat eye using 11100-2-AP

  Immunofluorescent analysis of (-20°C Acetone) fixed paraffin-embedded rat eye tissue using Arrestin C antibody (11100-2-AP) at dilution of 1:600 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Retinal organoids using 11100-2-AP

  Retinal organoids (day 220) generated from human induced pluripotent stem cells (iPSCs) and fixed with 4% PFA, Stained for Arrestin C with 11100-2-AP at 1:400. Nuclear stain DAPI (blue). Scale bar = 20 µm. Data generated by Alessandro Bellapianta at Johannes Kepler Universitat, Austria.

Arrestin C Polyclonal Antibody for WB, IF, ELISA

Cat No. 11100-2-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ARR3, Arrestin-C, ARRX, CAR, C-arrestin

---

Tested Applications

• Positive WB detected in: mouse eye tissue, human brain tissue, mouse heart tissue
• Positive IF detected in: Retinal organoids, mouse eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF): IF : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 6 publications below
• IF: See 1 publications below

Product Information

11100-2-AP targets Arrestin C in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1580

  Product name: Recombinant human ARR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC012096

  Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS

• Full Name: arrestin 3, retinal (X-arrestin)
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC012096
• Gene Symbol: Arrestin C
• Gene ID (NCBI): 407
• RRID: AB_2289959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36575
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Arrestin C, also known as Arrestin 3 or Retinal Cone Arrestin, is a protein encoded by the ARR3 gene. It belongs to the arrestin family, which plays a crucial role in regulating G-protein-coupled receptor (GPCR) signaling and trafficking. Arrestin C is composed of two major domains: the N-domain and the C-domain, connected by a hinge region. These domains form a structure resembling two clamshells placed end-to-end. The C-terminal tail (C-tail) of Arrestin C interacts extensively with the N-domain, stabilizing its basal conformation. Arrestin C is predominantly expressed in cone photoreceptors and pinealocytes in the retina. It is involved in the shut-off mechanisms associated with high-acuity color vision by binding to phosphorylated and activated opsins, thereby inhibiting their ability to interact with transducin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nat Commun; A high-risk retinoblastoma subtype with stemness features, dedifferentiated cone states and neuronal/ganglion cell gene expression.; Authors - Jing Liu
human	IHC	Cancers (Basel); Clinical, Genomic, and Pharmacological Study of MYCN-Amplified RB1 Wild-Type Metastatic Retinoblastoma.; Authors - Santiago Zugbi
human	WB	HGG Adv; Clinical features and molecular mechanisms of RP1L1 variants causing occult macular dystrophy; Authors - Yang Pan
human	IHC	Invest Ophthalmol Vis Sci; Establishment and Comprehensive Characterization of a Novel Preclinical Platform of Metastatic Retinoblastoma for Therapeutic Developments; Authors - Santiago Zugbi
human	IHC	BMC Cancer; Spatial transcriptomics of retinoblastoma: a visual window on intra-patient heterogeneity.; Authors - A P Moulin
human	IHC	Pediatr Blood Cancer; Immunohistochemical expression of TFF1 is a marker of poor prognosis in retinoblastoma; Authors - Rosario Aschero

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alessandro (Verified Customer) (01-19-2023)

great outcome, no unspecific staining

• Applications: Immunofluorescence