ASAH1 Polyclonal antibody

• 

  WB analysis using 11274-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11274-1-AP (ASAH1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11274-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11274-1-AP (ASAH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 11274-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using ASAH1 antibody (11274-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

ASAH1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11274-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AC, Acid ceramidase, Acid ceramidase subunit alpha, Acid ceramidase subunit beta, ASAH

---

Tested Applications

• Positive WB detected in: A549 cells, SH-SY5Y cells, MCF-7 cells, MDA-MB-231 cells, SW480 cells, T-47D cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 11 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

11274-1-AP targets ASAH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1799

  Product name: Recombinant human ASAH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-389 aa of BC016828

  Sequence: MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW

• Full Name: N-acylsphingosine amidohydrolase (acid ceramidase) 1
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC016828
• Gene Symbol: ASAH1
• Gene ID (NCBI): 427
• RRID: AB_2058719
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13510
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ASAH1, also named as AC, ACDase, Acid CDase, PHP32 and ASAH, belongs to the acid ceramidase family. ASAH1 is a lipid hydrolase that catalyzes the conversion of ceramide (cer) into sphingosine (SPH) and a free fatty acid. Mutation of ASAH1 will cause the Farber lipogranulomatosis (FL) which also known as Farber disease (FD). The predicted molecular weight of ASAH1 is 45 kDa. ASAH1 is a glycoprotein processed from a 55-60 kDa precursor via autoproteolytic cleavage into a mature heterodimeric enzyme formed by an α-subunit (13 kDa) and a β-subunit (37-40 kDa) (PMID: 22261821).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Acid ceramidase of macrophages traps herpes simplex virus in multivesicular bodies and protects from severe disease.; Authors - Judith Lang
mouse,human	WB	Cancer Res; Aneuploid cell survival relies upon sphingolipid homeostasis.; Authors - Yun-Chi Tang
human	WB	Hum Mol Genet; Acid ceramidase inhibition ameliorates α-synuclein accumulation upon loss of GBA1 function.; Authors - Myung Jong Kim
mouse	IF	BMC Genomics; Lipid metabolism-related genes are involved in the occurrence of asthma and regulate the immune microenvironment; Authors - Yuanmin Jia
mouse	WB	Int J Mol Sci; Hyperbaric Oxygen Treatment Ameliorates Hearing Loss and Auditory Cortex Injury in Noise Exposed Mice by Repressing Local Ceramide Accumulation.; Authors - Yu-Ting Su
human	WB	J Dermatol Sci; Th1 cytokines accentuate but Th2 cytokines attenuate ceramide production in the stratum corneum of human epidermal equivalents: an implication for the disrupted barrier mechanism in atopic dermatitis.; Authors - Sawada Eri E