ASAH1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASAH1 Polyclonal antibody (11274-1-AP)

ASAH1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11274-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AC, Acid ceramidase, Acid ceramidase subunit alpha, Acid ceramidase subunit beta, ASAH

• 

  WB analysis using 11274-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11274-1-AP (ASAH1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11274-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11274-1-AP (ASAH1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 11274-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using ASAH1 antibody (11274-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ASAH1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, T-47D cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11274-1-AP targets ASAH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1799

  Product name: Recombinant human ASAH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-389 aa of BC016828

  Sequence: MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW

• Full Name: N-acylsphingosine amidohydrolase (acid ceramidase) 1
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC016828
• Gene Symbol: ASAH1
• Gene ID (NCBI): 427
• RRID: AB_2058719
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13510
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ASAH1, also named as AC, ACDase, Acid CDase, PHP32 and ASAH, belongs to the acid ceramidase family. ASAH1 is a lipid hydrolase that catalyzes the conversion of ceramide (cer) into sphingosine (SPH) and a free fatty acid. Mutation of ASAH1 will cause the Farber lipogranulomatosis (FL) which also known as Farber disease (FD). The predicted molecular weight of ASAH1 is 45 kDa. ASAH1 is a glycoprotein processed from a 55 kDa precursor via autoproteolytic cleavage into a mature heterodimeric enzyme formed by an α-subunit (13 kDa) and a β-subunit (37-40 kDa) (PMID: 22261821).

Publications

What published studies show

ASAH1 Polyclonal antibody (Cat# 11274-1-AP) has 17 citations across journals including Nature Communications, Cancer Research, Science Translational Medicine, Phytomedicine, Cell Death Discovery, NPJ Science of Food, Life Metabolism, International Journal of Molecular Sciences, International Immunopharmacology, Molecular Medicine Reports, Journal of Dermatological Science, BMC Genomics, Infectious Drug Resistance, Human Molecular Genetics, Anatomical Record, and Archives of Dermatological Research. Associated research fields include lipid metabolism, ceramide homeostasis, cancer, neurodegeneration, liver disease, dermatology, and infectious disease.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cancer Res; Aneuploid cell survival relies upon sphingolipid homeostasis.; Authors - Yun-Chi Tang
human	WB	Nat Commun; Deficiency of the frontotemporal dementia gene GRN results in gangliosidosis; Authors - Sebastian Boland
mouse	WB	Nat Commun; Acid ceramidase of macrophages traps herpes simplex virus in multivesicular bodies and protects from severe disease.; Authors - Judith Lang
	WB,IF	Sci Transl Med; A 3D human retina model reveals a non-cell-autonomous and non-neuronal mechanism of photoreceptor loss in a lysosomal storage disorder; Authors - Jimin Han
mouse	WB	Phytomedicine; Schisandra chinensis lignans and polysaccharides alleviate MASH via ASAH1-mediated regulation of hepatic ceramide homeostasis.; Authors - Qi Chen ; KD Validated
human	WB	Cell Death Discov; Carmofur prevents cell cycle progression by reducing E2F8 transcription in temozolomide-resistant glioblastoma cells; Authors - Cyntanna C Hawkins