Use Able AI chat for product recommendations

ATF4 Polyclonal antibody

ATF4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

cAMP-dependent transcription factor ATF-4, CREB2, Cyclic AMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, TXREB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ATF4 in ?

Tested Applications

Positive WB detected inA431 cells, HeLa cells
Positive IP detected inA431 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inTunicamycin treated HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28657-1-AP targets ATF4 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29844

Product name: Recombinant human ATF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 206-351 aa of BC022088

Sequence: QCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predict reactive species
Full Name activating transcription factor 4 (tax-responsive enhancer element B67)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC022088
Gene Symbol ATF4
Gene ID (NCBI) 468
RRIDAB_2881187
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP18848
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation[PMID: 19016586]. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies[PMID: 19726872]. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia[PMID: 18163433]. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer. Endogenous ATF4 protein has a molecular mass of 50kd. [PMID: 17726049]. ATF4 can bind DNA as a homodimer and as a heterodimer. ATF4 is ubiquitinated by SCF(BTRC) in response to mTORC1 signal, followed by proteasomal degradation and leading to down-regulate expression of SIRT4, so the molecular weight of ATF4 may be 70 kDa.

Protocols

Product Specific Protocols
IF protocol for ATF4 antibody 28657-1-APDownload protocol
IHC protocol for ATF4 antibody 28657-1-APDownload protocol
IP protocol for ATF4 antibody 28657-1-APDownload protocol
WB protocol for ATF4 antibody 28657-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CHOP antibody (Cat# 28657-1-AP) has 16 total citations. Journals include Cell, Nature Communications, Science Translational Medicine, Molecular Therapy, Autophagy, Phytomedicine, Journal of Hazardous Materials, International Journal of Molecular Sciences, Molecular Neurobiology, Frontiers in Pharmacology, Inflammation, Oncology Reports, Molecular Genetics and Genomics, International Journal of Ophthalmology, bioRxiv, and Redox Biology. Research fields span cancer, ER stress, autophagy/mitophagy, ferroptosis, the integrated stress response, neurodegeneration, cardiovascular disease, and immunology.

SpeciesApplicationTitle
mouse,humanWB,IF

Cell

Cancer SLC6A6-mediated taurine uptake transactivates immune checkpoint genes and induces exhaustion in CD8+ T cells

Authors - Tianyu Cao
  • KD Validated
mouseWB

Autophagy

Epg5 deficiency leads to primary ovarian insufficiency due to WT1 accumulation in mouse granulosa cells.

Authors - Wenwen Liu
humanWB

Nat Commun

The integrated stress response suppresses PINK1-dependent mitophagy by preserving mitochondrial import efficiency.

Authors - Mingchong Yang
WB

Sci Transl Med

Selective translation of ZNF281 as part of the integrated stress response system has therapeutic relevance for cardio-oncology

Authors - Maria Areli Lorenzana-Carrillo
humanChIP

Mol Ther

Switch of ELF3 and ATF4 transcriptional axis programs the amino acid insufficiency-linked epithelial-to-mesenchymal transition

Authors - Jianxiang Lin
humanWB

Phytomedicine

Sculponeatin A promotes the ETS1-SYVN1 interaction to induce SLC7A11/xCT-dependent ferroptosis in breast cancer

Authors - Peng Peng

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

All three reviews are 5-star ratings. Users consistently report clear, specific bands in Western blot with good sensitivity and minimal non-specific signal. One reviewer also noted strong binding in tissue samples and immunoprecipitation applications. Fast shipping was highlighted as a positive experience. Overall, customers express high satisfaction with the antibody's specificity, sensitivity, and performance across multiple applications including WB, IF, IP, and cell culture.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Daney (Verified Customer) (07-13-2026)

This antibody gave clear bands in western blot. I appreciated that shipping was so fast. I placed the order the evening at the day before, and got the package the next day morning.

  • Applications: Western Blot, Immunofluorescence, Cell culture, Protein purification
  • Cell Tissue Type: 293T

Danyan (Verified Customer) (11-07-2025)

The antibody gave clear and specific bands in Western blot with good sensitivity.

  • Applications: Western Blot, Immunoprecipitation, Cell culture, Protein purification

Danyan (Verified Customer) (09-29-2025)

the antibody showed strong, specific binding in my tissue samples with little to no non-specific signal.

  • Applications: Western Blot, Immunoprecipitation, Cell culture
  • Cell Tissue Type: HEK293T
Loading...
||
New chat

Able™

正在加载,请稍候...