Tested Applications
| Positive WB detected in | A431 cells, HeLa cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Tunicamycin treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28657-1-AP targets ATF4 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29844 Product name: Recombinant human ATF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 206-351 aa of BC022088 Sequence: QCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP Predict reactive species |
| Full Name | activating transcription factor 4 (tax-responsive enhancer element B67) |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC022088 |
| Gene Symbol | ATF4 |
| Gene ID (NCBI) | 468 |
| RRID | AB_2881187 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18848 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation[PMID: 19016586]. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies[PMID: 19726872]. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia[PMID: 18163433]. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer. Endogenous ATF4 protein has a molecular mass of 50kd. [PMID: 17726049]. ATF4 can bind DNA as a homodimer and as a heterodimer. ATF4 is ubiquitinated by SCF(BTRC) in response to mTORC1 signal, followed by proteasomal degradation and leading to down-regulate expression of SIRT4, so the molecular weight of ATF4 may be 70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATF4 antibody 28657-1-AP | Download protocol |
| IHC protocol for ATF4 antibody 28657-1-AP | Download protocol |
| IP protocol for ATF4 antibody 28657-1-AP | Download protocol |
| WB protocol for ATF4 antibody 28657-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CHOP antibody (Cat# 28657-1-AP) has 16 total citations. Journals include Cell, Nature Communications, Science Translational Medicine, Molecular Therapy, Autophagy, Phytomedicine, Journal of Hazardous Materials, International Journal of Molecular Sciences, Molecular Neurobiology, Frontiers in Pharmacology, Inflammation, Oncology Reports, Molecular Genetics and Genomics, International Journal of Ophthalmology, bioRxiv, and Redox Biology. Research fields span cancer, ER stress, autophagy/mitophagy, ferroptosis, the integrated stress response, neurodegeneration, cardiovascular disease, and immunology.
| Species | Application | Title |
|---|---|---|
Cell Cancer SLC6A6-mediated taurine uptake transactivates immune checkpoint genes and induces exhaustion in CD8+ T cells
| ||
Autophagy Epg5 deficiency leads to primary ovarian insufficiency due to WT1 accumulation in mouse granulosa cells. | ||
Nat Commun The integrated stress response suppresses PINK1-dependent mitophagy by preserving mitochondrial import efficiency. | ||
Sci Transl Med Selective translation of ZNF281 as part of the integrated stress response system has therapeutic relevance for cardio-oncology | ||
Mol Ther Switch of ELF3 and ATF4 transcriptional axis programs the amino acid insufficiency-linked epithelial-to-mesenchymal transition | ||
Phytomedicine Sculponeatin A promotes the ETS1-SYVN1 interaction to induce SLC7A11/xCT-dependent ferroptosis in breast cancer |
Reviews
What customers say
All three reviews are 5-star ratings. Users consistently report clear, specific bands in Western blot with good sensitivity and minimal non-specific signal. One reviewer also noted strong binding in tissue samples and immunoprecipitation applications. Fast shipping was highlighted as a positive experience. Overall, customers express high satisfaction with the antibody's specificity, sensitivity, and performance across multiple applications including WB, IF, IP, and cell culture.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Daney (Verified Customer) (07-13-2026) | This antibody gave clear bands in western blot. I appreciated that shipping was so fast. I placed the order the evening at the day before, and got the package the next day morning.
|
Danyan (Verified Customer) (11-07-2025) | The antibody gave clear and specific bands in Western blot with good sensitivity.
|
Danyan (Verified Customer) (09-29-2025) | the antibody showed strong, specific binding in my tissue samples with little to no non-specific signal.
|
