• Featured Product
  • KD/KO Validated

ATG16L1 Polyclonal antibody

ATG16L1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 29445-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

APG16 like 1, APG16L, APG16-like 1, ATG16L, Autophagy-related protein 16-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, HepG2 cells, HSC-T6 cells, HEK-293 cells, MCF-7 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29445-1-AP targets ATG16L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31318

Product name: Recombinant human ATG16L1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-230 aa of BC000061

Sequence: NKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLS

Predict reactive species
Full Name ATG16 autophagy related 16-like 1 (S. cerevisiae)
Calculated Molecular Weight 607 aa, 68 kDa
Observed Molecular Weight68-75 kDa
GenBank Accession NumberBC000061
Gene Symbol ATG16L1
Gene ID (NCBI) 55054
RRIDAB_2918308
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ676U5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 66 kDa; and Atg16L1β, 68 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931)

Protocols

Product Specific Protocols
IF protocol for ATG16L1 antibody 29445-1-APDownload protocol
IHC protocol for ATG16L1 antibody 29445-1-APDownload protocol
WB protocol for ATG16L1 antibody 29445-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Nanobiotechnology

Engineering exosomes derived from TNF-α preconditioned IPFP-MSCs enhance both yield and therapeutic efficacy for osteoarthritis

Authors - Jiangyi Wu
humanIHC

Cell Signal

Inhibition of XIST restrains paclitaxel resistance in breast cancer cells by targeting hsa-let-7d-5p/ATG16L1 through regulation of autophagy

Authors - Yueyue Wang
mouseWB

Food Funct

EPA and DHA differentially coordinate the crosstalk between host and gut microbiota and block DSS-induced colitis in mice by a reinforced colonic mucus barrier.

Authors - Jian Fang
humanWB

Anticancer Drugs

Purvalanol A induces apoptosis and reverses cisplatin resistance in ovarian cancer

Authors - Xiaoyi Zhang
humanIHC

Schizophr Res

Histopathological evidence of cellular alterations in the dentate gyrus is associated with aberrant RB1CC1-ATG16L1 expression in the hippocampus among older adults with chronic schizophrenia: A pilot post-mortem study

Authors - Andreas S Lappas
humanIF

Nat Cell Biol

Rpl12 is a conserved ribophagy receptor

Authors - Yuting Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boel (Verified Customer) (07-30-2025)

25µg gastrocnemius muscle total protein extract from mdx mouse (dystrophin deficient mice that are used as a model for Duchenne muscular dystrophy) generated a strong band of full lenght protein plus multiple additional bands of lower molecular weight. 25µg of total protein extract from pooled wild type zebrafish 5 days post fertilization generated no protein bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: mouse muscle, zebrafish total extract
ATG16L1 Antibody Western Blot validation (1/500 dilution) in mouse muscle, zebrafish total extract (Cat no:29445-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...