ATP1B1 Polyclonal antibody

ATP1B1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 15192-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Sodium/potassium-transporting ATPase subunit beta-1, Sodium/potassium-dependent ATPase subunit beta-1, Na+/K+ ATPase beta 1 subunit, Na, K-ATPase β1, Beta 1 subunit of Na(+) K(+) ATPase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human heart tissue, human brain tissue, mouse heart tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman brain tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15192-1-AP targets ATP1B1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7279

Product name: Recombinant human ATP1B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-303 aa of BC000006

Sequence: LTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Predict reactive species
Full Name ATPase, Na+/K+ transporting, beta 1 polypeptide
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 45-52 kDa
GenBank Accession NumberBC000006
Gene Symbol ATP1B1
Gene ID (NCBI) 481
RRIDAB_2290040
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05026
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)

Protocols

Product Specific Protocols
WB protocol for ATP1B1 antibody 15192-1-APDownload protocol
IHC protocol for ATP1B1 antibody 15192-1-APDownload protocol
IF protocol for ATP1B1 antibody 15192-1-APDownload protocol
IP protocol for ATP1B1 antibody 15192-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF, WB

J Immunol

Inducible ATP1B1 Upregulates Antiviral Innate Immune Responses by the Ubiquitination of TRAF3 and TRAF6.

Authors - Wei Cao
mouseIF

Mol Biol Cell

Retinoschisin is linked to retinal Na/K-ATPase signaling and localization.

Authors - Karolina Plössl
human,mouseWB,IHC

Front Pharmacol

High-Salt Attenuates the Efficacy of Dapagliflozin in Tubular Protection by Impairing Fatty Acid Metabolism in Diabetic Kidney Disease

Authors - Meina Zou
ratWB

Int J Mol Sci

RBM20 Regulates CaV1.2 Surface Expression by Promoting Exon 9* Inclusion of CACNA1C in Neonatal Rat Cardiomyocytes.

Authors - Akihito Morinaga
mouseWB

Obesity (Silver Spring)

27-Hydroxycholesterol Inhibits Sterol Regulatory Element-Binding Protein 1 Activation and Hepatic Lipid Accumulation in Mice.

Authors - Di Li
humanWB

Exp Eye Res

Pathomechanism of mutated and secreted retinoschisin in X-linked juvenile retinoschisis.

Authors - Karolina Plössl
Loading...
||
New chat Able
正在加载,请稍候...