Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HT-1080 cells, PC-12 cells, NIH/3T3 cells, Raji cells, mouse kidney tissue, rat kidney tissue, rat colon tissue, rat lung tissue, BALB/3T3 clone A31, RAW 264.7 cells, rat brain tissue, mouse heart tissue |
| Positive IP detected in | Raji cells, mouse heart tissue |
| Positive IHC detected in | mouse lung tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 19 publications below |
| WB | See 4649 publications below |
| IHC | See 251 publications below |
| IF | See 9 publications below |
| IP | See 13 publications below |
| ELISA | See 2 publications below |
| CoIP | See 3 publications below |
Product Information
50599-2-Ig targets BAX in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, monkey, sheep, goat, deer |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0576 Product name: Recombinant human BAX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC014175 Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG Predict reactive species |
| Full Name | BCL2-associated X protein |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC014175 |
| Gene Symbol | BAX |
| Gene ID (NCBI) | 581 |
| RRID | AB_2061561 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q07812 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BAX (also known as BCL2 Associated X, Bcl-2-Like Protein 4, Bcl2-L-4, BCL2L4) is a member of the BCL2 family of proteins that play a key role in the regulation of apoptosis in higher eukaryotes (https://www.uniprot.org/uniprot/Q07812). BAX comprises 4 Bcl-2 homology domains (BH1-BH4) and a C-terminal transmembrane domain. In healthy mammalian cells, BAX is localized to the cytoplasm through its interaction with the anti-apoptotic BL-2 family members BCL2L1/Bcl-xL (PMIDs: 28755482, 21458670). In response to apoptotic stimuli, however, BAX undergoes a conformational change that causes it to translocate to the outer mitochondrial membrane where it initiates the mitochondrial pathway of apoptosis via two potential mechanisms. Firstly, upon translocation to the outer mitochondrial membrane, BAX interacts with the mitochondrial voltage-dependent anion channel (VDAC) leading to the opening of the channel, loss of membrane potential, and the release of cytochrome c from the mitochondrion (PMID:10766872). The release of cytochrome C into the cytoplasm leads to the activation of Caspase3, initiating apoptosis. Secondly, activated BAX forms homodimers, which then assemble into oligomers on the mitochondrial outer membrane to create pores that permeabilize the mitochondrion leading to the release of cytochrome C (PMID:25458844).
BAX has been shown to be involved in p53-mediated apoptosis. Expression of the human bax gene has been shown to be directly regulated by p53, and the bax promoter contains four motifs with homology to consensus p53-binding sites (PMID:7834749). Furthermore, p53 directly interacts with BAX to promote its activation (PMID:14963330).
What is the molecular weight of BAX?
BAX is a 192 amino acid protein that has a predicted molecular weight of 21.1 kDa.
What is the subcellular localization of BAX?
In healthy mammalian cells, BAX is localized to the cytoplasm. In response to apoptotic stimuli, BAX translocates to the outer mitochondrial membrane.
What is the tissue specificity of BAX?
BAX is ubiquitously expressed (PMID: 25613900).
What is the connection between BAX and cancer?
BAX appears to play an important role in suppressing cancer development, and decreased BAX levels are associated with chemo- and radioresistance in a number of cancers including lung cancer, chronic lymphocytic leukemia (CLL), and prostate cancer. Loss-of-function mutations of BAX have also been reported in hematopoietic malignancies in humans (PMID:9531611) and in gastrointestinal cancer of the microsatellite mutator phenotype (MMP), where BAX inactivation contributes to tumor progression by providing a survival advantage (PMID:9331106).
A number of anticancer drugs used clinically have been demonstrated to induce BAX activation indirectly to facilitate apoptosis of tumor cells. Recent efforts have demonstrated that BAX itself may be a promising direct target for small-molecule drug discovery for novel anticancer drugs and several direct BAX activators have been identified that may hold promise for cancer therapy, with the potential to overcome chemo- and radioresistance (PMID:25230299).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BAX antibody 50599-2-Ig | Download protocol |
| IHC protocol for BAX antibody 50599-2-Ig | Download protocol |
| IP protocol for BAX antibody 50599-2-Ig | Download protocol |
| WB protocol for BAX antibody 50599-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioact Mater Chemo-immunotherapy by dual-enzyme responsive peptide self-assembling abolish melanoma | ||
ACS Nano Melatonin-Derived Carbon Dots with Free Radical Scavenging Property for Effective Periodontitis Treatment via the Nrf2/HO-1 Pathway | ||
ACS Nano Nanointegrative In Situ Reprogramming of Tumor-Intrinsic Lipid Droplet Biogenesis for Low-Dose Radiation-Activated Ferroptosis Immunotherapy | ||
ACS Nano Mitochondria-Targeted Microneedles Reverse Doxorubicin Resistance via Apoptosis-Ferroptosis Synergy | ||
Mol Cell Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sai Sindhura (Verified Customer) (01-08-2026) | BAX antibody worked very good
|
FH Mounika (Verified Customer) (01-08-2026) | Wonderful antibodies , bright bands!
|
FH Charlotte (Verified Customer) (08-15-2024) | Intense band at the expected MW
![]() |
FH Macarena Lucia (Verified Customer) (10-17-2022) | nice band
|
FH ZEE (Verified Customer) (07-13-2020) | VERY GOOD antibody when western
|
FH Tanusree (Verified Customer) (12-18-2019) | Product worked well in WB at 1:500 dilution
|
FH Kathryn (Verified Customer) (11-04-2019) | Image shows a post-natal day 2 mouse ovary with germ cells marked by TRA98 (Abcam) in green, and BAX (Proteintech) marked in red.
![]() |







































