• Featured Product
  • KD/KO Validated

BCAS3 Polyclonal antibody

BCAS3 Polyclonal Antibody for WB, ELISA
Cat No. 10402-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

BCAS3, GAOB1, MAAB, Protein Maab1, Rudhira

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, A431 cells, HeLa cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10402-1-AP targets BCAS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0646

Product name: Recombinant human BCAS3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 653-928 aa of BC001250

Sequence: SWTLVRTPQWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP

Predict reactive species
Full Name breast carcinoma amplified sequence 3
Calculated Molecular Weight 99 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC001250
Gene Symbol BCAS3
Gene ID (NCBI) 54828
RRIDAB_10897181
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H6U6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rudhira/BCAS3 (Breast Cancer Amplified Sequence 3) is a conserved protein expressed in the embryonic vasculature and malignant tumors. Rudhira is a predicted WD40 domain protein. During mouse development Rudhira is expressed in erythropoietic and angiogenic precursors but not in their differentiated progeny. This transient expression of Rudhira is also seen in normal adult angiogenesis. BCAS3, the human ortholog of Rudhira is 98% identical and the gene maps to a breakpoint of hematological neoplasms on chromosome 17q23.1. BCAS3 is also expressed in vascular development in embryoid bodies in vitro and was originally identified as a gene over-expressed in breast cancers. It is reported to be a target of metastasis associated protein-1 (MTA-1). Further BCAS3 expression is also upregulated in grade III and IV glioblastomas where it is misexpressed in the tumor cells.

Protocols

Product Specific Protocols
WB protocol for BCAS3 antibody 10402-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...