Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue |
| Positive IHC detected in | mouse cerebellum tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 48 publications below |
| IHC | See 11 publications below |
| IF | See 7 publications below |
Product Information
25699-1-AP targets BDNF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, macaque |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22489 Product name: Recombinant human BDNF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 130-179 aa of BC029795 Sequence: SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ Predict reactive species |
| Full Name | brain-derived neurotrophic factor |
| Calculated Molecular Weight | 247 aa, 28 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC029795 |
| Gene Symbol | BDNF |
| Gene ID (NCBI) | 627 |
| RRID | AB_3669493 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23560 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
1) What is BDNF?
BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.
2) FAQs for BDNF
A) I can detect more than one band in my samples
BDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BDNF antibody 25699-1-AP | Download protocol |
| IHC protocol for BDNF antibody 25699-1-AP | Download protocol |
| WB protocol for BDNF antibody 25699-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Ther Nucleic Acids Exploring the therapeutic potential of sγPNA-141: Pharmacodynamics and mechanistic insights during ischemic stroke recovery | ||
Phytomedicine Yindan Xinnaotong Soft Capsule improves post-ischemic stroke recovery by regulating CREB/BDNF-mediated synaptic plasticity and CREB/VEGFA-mediated angiogenesis | ||
Sci Signal Glutamatergic argonaute2 promotes the formation of the neurovascular unit in mice | ||
J Neurosci Early BDNF Treatment Ameliorates Cell Loss in the Entorhinal Cortex of APP Transgenic Mice. | ||
Neuropsychopharmacology CPEB3-dowregulated Nr3c1 mRNA translation confers resilience to developing posttraumatic stress disorder-like behavior in fear-conditioned mice. | ||
Cell Mol Life Sci Furin promotes dendritic morphogenesis and learning and memory in transgenic mice. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Samantha (Verified Customer) (10-02-2025) | My lab frequently orders antibodies from Proteintech because of the quality and the speed with which they are delivered. This time was no different! This antibody worked extremely well.
|
FH Armelle (Verified Customer) (09-03-2019) | This antibody worked very well. We were able to quantify expression levels in our area of interest.
![]() |












