Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue |
| Positive IHC detected in | mouse cerebellum tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25699-1-AP targets BDNF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, monkey, macaque |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22489 Product name: Recombinant human BDNF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 130-179 aa of BC029795 Sequence: SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ Predict reactive species |
| Full Name | brain-derived neurotrophic factor |
| Calculated Molecular Weight | 247 aa, 28 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC029795 |
| Gene Symbol | BDNF |
| Gene ID (NCBI) | 627 |
| RRID | AB_3669493 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23560 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
1) What is BDNF?
BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.
2) FAQs for BDNF
A) I can detect more than one band in my samples
BDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BDNF antibody 25699-1-AP | Download protocol |
| IHC protocol for BDNF antibody 25699-1-AP | Download protocol |
| WB protocol for BDNF antibody 25699-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-BDNF antibody (Cat# 25699-1-AP) has accumulated 92 citations across journals including Biomaterials, Cell Reports, Journal of Neuroscience, Brain, Behavior & Immunity, Science Signaling, Acta Pharmaceutica Sinica B, Experimental Molecular Medicine, Cancer Letters, Journal of Neuroinflammation, Phytomedicine, International Journal of Molecular Sciences, Neuropsychopharmacology, Neuropharmacology, and others. Citations span neuroscience fields such as stroke recovery, depression and anxiety, Alzheimer's disease, cognitive impairment, neuroinflammation, peripheral nerve regeneration, synaptic plasticity, and neuroprotection.
| Species | Application | Title |
|---|---|---|
Exp Mol Med Neuron type-specific optogenetic stimulation for differential stroke recovery in chronic capsular infarct | ||
Acta Pharm Sin B High glucose induces hippocampal neuron impairment through the SKP1/COX7C pathway: A potential mechanism for perimenopausal depression. | ||
Biomaterials Hydrogen-releasing electroactive nerve guidance conduits promote peripheral nerve regeneration by remodeling the microenvironment | ||
Cancer Lett NEAT1 Promotes the Perineural Invasion of Pancreatic Cancer via the E2F1/GDNF Axis | ||
J Neuroinflammation Microglial Ccl4-Ccr5 signaling links systemic inflammation to synaptic loss and memory deficits in chronic kidney disease. | ||
Phytomedicine Renshen decoction improves myocardial energy metabolism in heart failure by regulating exosomal miR-30e-5p. |
Reviews
What customers say
All three reviewers gave 5-star ratings. The antibody was used for Western Blot, Immunohistochemistry, and Immunofluorescence on mouse brain tissue. Users reported minimal background with optimal results in IF applications, and one reviewer noted they were able to successfully quantify expression levels in their region of interest. Overall, customers praised the antibody's performance and reliability, with one mentioning consistent quality and fast delivery from Proteintech.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shazia (Verified Customer) (02-03-2026) | Used it for IF in mouse brain tissue and it nicely worked giving you minimum background with optimum results.
|
Samantha (Verified Customer) (10-02-2025) | My lab frequently orders antibodies from Proteintech because of the quality and the speed with which they are delivered. This time was no different! This antibody worked extremely well.
|
Armelle (Verified Customer) (09-03-2019) | This antibody worked very well. We were able to quantify expression levels in our area of interest.
 |
