Tested Applications
| Positive WB detected in | COLO 320 cells, HeLa cells, HepG2 cells, mouse skeletal muscle tissue, pig cartilage tissue |
| Positive IHC detected in | human lung cancer tissue, human colon cancer tissue, human kidney tissue, human liver tissue, human liver cancer tissue, human lung tissue, human renal cell carcinoma tissue, human stomach cancer tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16409-1-AP targets Biglycan in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0683 Product name: Recombinant human Biglycan protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-368 aa of BC004244 Sequence: MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK Predict reactive species |
| Full Name | biglycan |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 40-48 kDa |
| GenBank Accession Number | BC004244 |
| Gene Symbol | Biglycan |
| Gene ID (NCBI) | 633 |
| RRID | AB_10804656 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21810 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Biglycan is a member of the small leucine-rich proteoglycan (SLRP) family (PMID: 18463092). It consists of a core protein of 42 kDa containing leucine-rich repeats (LRRs), to which two chondroitin/dermatan sulfate side chains are covalently bound (PMID: 2212616; 10383378). The tissue-specific chondroitin- or dermatan-sulfate glycosaminoglycan chains of biglycan are attached to amino acid residues at the N-terminus of the core protein (PMID: 22821552). Biglycan is a ubiquitous component of connective tissue matrix and may act as a signaling molecule (PMID: 22821552). Upregulation of biglycan has been reported in multiple types of solid cancer (PMID: 32194659).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Biglycan antibody 16409-1-AP | Download protocol |
| IHC protocol for Biglycan antibody 16409-1-AP | Download protocol |
| WB protocol for Biglycan antibody 16409-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Biglycan Polyclonal antibody (catalog number 16409-1-AP) has 43 citations. These appear in journals including Theranostics, Advanced Science, Biomaterials, Cell Death & Disease, Acta Biomaterialia, Oncoimmunology, International Journal of Molecular Sciences, FASEB Journal, BMC Cancer, Cancers, and others. Research fields span cancer biology (breast, thyroid, prostate, esophageal, lung, gastric, and ovarian cancers), tumor microenvironment and cancer-associated fibroblasts, tendon and bone regeneration, osteoporosis, fibrosis, extracellular matrix biology, and proteomics. Applications mainly include Western blot, immunohistochemistry, and immunofluorescence.
| Species | Application | Title |
|---|---|---|
J Nanobiotechnology Youthful small extracellular vesicles restore the function and reparative capacity of inflammatory-impaired periodontal ligament stem cells via delivering protein biglycan for bone regeneration
| ||
Theranostics Enhancer-mediated NR2F2 recruitment activates BGN to promote tumor growth and shape tumor microenvironment in papillary thyroid cancer.
| ||
Adv Sci (Weinh) BGN/MDK Axis in the Melanoma Tumor Microenvironment Strengthens Tumor Malignancy by Modulating Cancer Cells and Cancer-Associated Fibroblasts Crosstalk | ||
Biomaterials Genetically engineered extracellular vesicles-based collagen-targeting bioinspired scaffold for tendon regenerative repair.
| ||
Cell Death Dis Mmu-miR-185 depletion promotes osteogenic differentiation and suppresses bone loss in osteoporosis through the Bgn-mediated BMP/Smad pathway. | ||
Acta Biomater Rejuvenation of tendon stem/progenitor cells for functional tendon regeneration through platelet-derived exosomes loaded with recombinant Yap1 |
Reviews
What customers say
Users report strong performance for immunofluorescence and immunohistochemistry. At 1:100 dilution, the antibody worked well on mouse tissue for both IF and IHC. For IF on MC3T3 cells, a 1:500 dilution gave clean results, though higher concentrations (e.g., 1:200) produced nonspecific extracellular aggregates. One IHC application on placenta used a Leica Bond Rxm platform with ER1 antigen retrieval at 1:500 dilution, yielding satisfactory staining. Overall, reviewers rate the antibody favorably, with most giving 5 stars and one giving 4 stars due to the dilution sensitivity noted.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (10-14-2025) | VERY GOOD FOR IF
|
MALLIKARJUNA (Verified Customer) (10-14-2025) | good antibody
|
Lin (Verified Customer) (11-18-2024) | Cells were fixed in 4% PFA, permeabilized with .1% Triton, and blocked for 1 hour. 1o was incubated overnight in 1% BSA followed by 2o incubation for 1hr and imaging. More concentrated dilutions than 1:500 (eg 1:200) produced nonspecific aggregates outside of cells that were not seen in 2o only control.
|
Federica (Verified Customer) (12-08-2023) | Leica Bond Rxm Red Chronogenic Kit Antigen Retrival ER1 (ph6) for 30 min
 |
