BMPR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BMPR2 Polyclonal antibody (14376-1-AP)

BMPR2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 14376-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

BMP type 2 receptor, BMP type II receptor, BMP type-2 receptor, BMPR 2, BMPR II

• 

  WB analysis using 14376-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14376-1-AP (BMPR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 14376-1-AP

  IP result of anti-BMPR2 (IP:14376-1-AP, 4ug; Detection:14376-1-AP 1:500) with mouse brain tissue lysate 6500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BMPR2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14376-1-AP targets BMPR2 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5752

  Product name: Recombinant human BMPR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 172-504 aa of BC052985

  Sequence: YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL

• Full Name: bone morphogenetic protein receptor, type II (serine/threonine kinase)
• Calculated Molecular Weight: 115 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC052985
• Gene Symbol: BMPR2
• Gene ID (NCBI): 659
• RRID: AB_10639044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13873
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BMPs (bone morphogenetic protein) are involved in endochondral bone formation and embryogenesis. BMPR2 encodes a member of the (BMP) receptor family of transmembrane serine/threonine kinases. It is a widely expressed receptor, with high mRNA expression during development in many tissues. Dimer of BMPR2 receptors (70-80 kD) forms a complex with a dimer of type I BMPR1(50-55 kD) in signal transduction. This antibody recognizes endogenous levels of total BMPR2 protein, including 115 kD precursor, 75 kD mature form and 150 kD dimer.

Publications

What published studies show

The BMPR2 Polyclonal antibody (Cat# 14376-1-AP) has 13 citations across journals including Cell Reports, Journal of Advanced Research, Arteriosclerosis, Thrombosis and Vascular Biology, JACC Basic Translational Science, Frontiers in Pharmacology, Experimental Gerontology, Scientific Reports, BMC Complementary Medicine and Therapies, BMC Genomics, International Journal of Medical Sciences, Journal of Neuro-Oncology, Biomedical Research International, and Biochemical and Biophysical Research Communications. Research fields span pulmonary hypertension, atherosclerosis, ischemic stroke, BMP/Smad signaling, glioma, idiopathic pulmonary fibrosis, kidney injury, and acute myeloid leukemia.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Adv Res; LncRNA NIPA1-SO confers atherosclerotic protection by suppressing the transmembrane protein NIPA1; Authors - Min Jiang
rat	WB	Arterioscler Thromb Vasc Biol; Binding of Hypoxia-Induced Mitogenic Factor/RELM-β to Bone Morphogenetic Protein Receptor 2 Complex Promotes Pulmonary Hypertension.; Authors - Ting Zhang
		JACC Basic Transl Sci; Hypoxanthine Promotes Pulmonary Vascular Remodeling and Adenosine Deaminase Is a Therapeutic Target for Pulmonary Hypertension; Authors - Jun-Zhuo Shi
human	CoIP	Cell Rep; Matrilin-3 supports neuroprotection in ischemic stroke by suppressing astrocyte-mediated neuroinflammation; Authors - Xianyong Zhou
rat	WB	Front Pharmacol; Novel Pyrazolo[3,4-b] Pyridine Derivative (HLQ2g) Attenuates Hypoxic Pulmonary Hypertension via Restoring cGKI Expression and BMP Signaling Pathway; Authors - Lijun Li
mouse	WB	Exp Gerontol; AGEs-RAGE axis causes endothelial-to-mesenchymal transition in early calcific aortic valve disease via TGF-β1 and BMPR2 signaling.; Authors - Guorong Deng