C1orf54 Polyclonal antibody

• 

  IHC staining of mouse kidney using 30247-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30247-1-AP (C1orf54 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 30247-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30247-1-AP (C1orf54 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 30247-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using C1orf54 antibody (30247-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse kidney using 30247-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using C1orf54 antibody (30247-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

C1orf54 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 30247-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

C1orf54, FLJ23221

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30247-1-AP targets C1orf54 in IHC, IF-P, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32876

  Product name: Recombinant human C1orf54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-131 aa of BC017761

  Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

• Full Name: chromosome 1 open reading frame 54
• GenBank Accession Number: BC017761
• Gene Symbol: C1orf54
• Gene ID (NCBI): 79630
• RRID: AB_3086279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWF1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1orf54 is a newly identified protein encoded by an open reading frame on chromosome 1. C1orf54 is highly expressed in healthy mouse kidneys and is only expressed in tubular epithelial cells (TECs), not in glomeruli(PMID: 29999589). C1orf54 promotes renal repair and TEC proliferation through PI3K/AKT signalling, which alleviates kidney damage after ischaemia‐reperfusion injury (IRI) (PMID: 29999589).