C9orf72 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C9orf72 Polyclonal antibody (22637-1-AP)

• Featured Product
• KD/KO Validated

C9orf72 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22637-1-AP Copied!

Publications (39)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

C9RANT, DENND9, DENNL72, Guanine nucleotide exchange factor C9orf72

• 

  WB analysis of rat brain using 22637-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22637-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22637-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 22637-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22637-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of transfected cells using 22637-1-AP

  WB result of anti-C9ORF72 (22637-1-AP) with Variant1 and 2 transfected. (by Dr. Sarah Mueller).

• 

  WB analysis of SH-SY5Y using 22637-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Sp2/0 using 22637-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 22637-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SH-SY5Y using 22637-1-AP

  IP result of anti-C9orf72 (IP:22637-1-AP, 3ug; Detection:22637-1-AP 1:300) with SH-SY5Y cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 22637-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using C9orf72 antibody (22637-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C9orf72 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: C2C12 cells, HeLa cells, mouse testis tissue, rat brain tissue, SH-SY5Y cells, Sp2/0 cells, transfected cells, HEK-293 cells, NIH/3T3 cells, 3T3-L1 cells
• Positive IP detected in: SH-SY5Y cells
• Positive IHC detected in: human gliomas tissue, human testis tissue, mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22637-1-AP targets C9orf72 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, caenorhabditis elegans
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18326

  Product name: Recombinant human C9orf72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-169 aa of BC020851

  Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG

• Full Name: chromosome 9 open reading frame 72
• Calculated Molecular Weight: 481 aa, 54 kDa
• Observed Molecular Weight: 50-54 kDa
• GenBank Accession Number: BC020851
• Gene Symbol: C9orf72
• Gene ID (NCBI): 203228
• RRID: AB_10953528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LT7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. It has been reported that C9orf72 forms a complex with Cofilin and other actin binding proteins and 22637-1-AP antibody detects the complex bands around 43 and 68-72 kDa in SDS-PAGE.(PMID: 27723745)

Publications

What published studies show

The C9orf72 Polyclonal antibody (Cat# 22637-1-AP) has 39 citations. Journals include Nature Medicine, Science, Cell Metabolism, Nature Neuroscience, Nature Communications, Neuron, Science Translational Medicine, EMBO Journal, Acta Neuropathologica, Cell Reports, eLife, and others. Research fields center on ALS/FTD neurodegeneration, C9orf72 repeat expansion, autophagy, stress granules, neuroinflammation, and metabolic regulation, using applications such as WB, IF, IHC, CoIP, and ELISA across human, mouse, rat, and C. elegans models.

Automatically generated from the 39 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	wb	Nat Med; Haploinsufficiency leads to neurodegeneration in C9ORF72 ALS/FTD human induced motor neurons.; Authors - Yingxiao Shi
mouse	WB	Science; C9orf72 is required for proper macrophage and microglial function in mice.; Authors - J G O'Rourke ; KO Validated
mouse,human	WB,CoIP	Cell Metab; C9orf72 regulates energy homeostasis by stabilizing mitochondrial complex I assembly.; Authors - Tao Wang ; KO Validated
mouse,human	WB	Nat Neurosci; Reduced C9ORF72 function exacerbates gain of toxicity from ALS/FTD-causing repeat expansion in C9orf72.; Authors - Qiang Zhu ; KO Validated
	WB	Nat Commun; A high-fidelity CRISPR-Cas13 system improves abnormalities associated with C9ORF72-linked ALS/FTD; Authors - Tristan X McCallister
human	WB	Nat Commun; C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy; Authors - Shen Zhang ; KO Validated