Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, mouse colon tissue, NCI-H1299 cells, rat kidney tissue, HepG2 cells, LNCaP cells, MCF-7 cells, SKOV-3 cells, THP-1 cells, mouse kidney tissue |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human pancreas cancer tissue, human colon tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14787-1-AP targets CBS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6437 Product name: Recombinant human CBS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 206-551 aa of BC000440 Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK Predict reactive species |
| Full Name | cystathionine-beta-synthase |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 61-63 kDa |
| GenBank Accession Number | BC000440 |
| Gene Symbol | CBS |
| Gene ID (NCBI) | 875 |
| RRID | AB_2070970 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35520 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CBS antibody 14787-1-AP | Download protocol |
| IHC protocol for CBS antibody 14787-1-AP | Download protocol |
| IP protocol for CBS antibody 14787-1-AP | Download protocol |
| WB protocol for CBS antibody 14787-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CBS antibody (Cat# 14787-1-AP) has accumulated 159 citations published in journals including Cell Metabolism, Nature Communications, Molecular Cell, Redox Biology, Journal of Clinical Investigation, Cancer Research, eLife, and FASEB Journal. Key research fields encompass hydrogen sulfide signaling, cysteine and transsulfuration pathway metabolism, cardiovascular disease, cancer biology, neuroscience, diabetes, ferroptosis, inflammation, obesity, and aging.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther B cell-derived anti-beta 2 glycoprotein I antibody mediates hyperhomocysteinemia-aggravated hypertensive glomerular lesions by triggering ferroptosis | ||
Cell Metab Mitochondrial dysfunction reveals H(2)S-mediated synaptic sulfhydration as a potential mechanism for autism-associated social defects. | ||
Cancer Res PRMT1 sustains de novo fatty acid synthesis by methylating PHGDH to drive chemoresistance in triple-negative breast cancer | ||
Cancer Res Upregulation of Cystathionine-β-synthase in Colonic Epithelia Reprograms Metabolism and Promotes Carcinogenesis. | ||
Nat Commun Remote ischemic conditioning counteracts the intestinal damage of necrotizing enterocolitis by improving intestinal microcirculation. | ||
J Adv Res Endogenous hydrogen sulfide improves vascular remodeling through PPARδ/SOCS3 signaling. |
