• Featured Product
  • KD/KO Validated

CBX5 Polyclonal antibody

CBX5 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11831-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, chIP, ELISA

Antigen p25, CBX5, Chromobox protein homolog 5, HP1, HP1 alpha, HP1A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human kidney tissue, K-562 cells, A431 cells, MCF-7 cells, HEK-293 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11831-1-AP targets CBX5 in WB, IHC, IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2403

Product name: Recombinant human CBX5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-191 aa of BC006821

Sequence: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS

Predict reactive species
Full Name chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Calculated Molecular Weight 191 aa, 22 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC006821
Gene Symbol CBX5
Gene ID (NCBI) 23468
RRIDAB_2071356
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP45973
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443). This antibody is a rabbit polyclonal antibody raised against a full-length human HP1A protein ,and can reacts with the 28kd HP1A protein.

Protocols

Product Specific Protocols
IHC protocol for CBX5 antibody 11831-1-APDownload protocol
IP protocol for CBX5 antibody 11831-1-APDownload protocol
WB protocol for CBX5 antibody 11831-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IP

J Exp Med

ZNF382 controls mouse neuropathic pain via silencer-based epigenetic inhibition of Cxcl13 in DRG neurons.

Authors - Longfei Ma
mouseWB

Nat Commun

The histone H3K9 methyltransferase SUV39H links SIRT1 repression to myocardial infarction.

Authors - Guang Yang
humanWB,chIP

Cancer Res

ZNF143-Mediated H3K9 Trimethylation Upregulates CDC6 by Activating MDIG in Hepatocellular Carcinoma.

Authors - Lili Zhang
humanWB

Sci Rep

Exploration of common pathogenic genes between cerebral amyloid angiopathy and insomnia based on bioinformatics and experimental validation

Authors - Xin-Yu Li
humanWB

Asian Pac J Cancer Prev

Triptolide Promotes Senescence of Prostate Cancer Cells Through Histone Methylation and Heterochromatin Formation

Authors - Ousman Tamgue
mouseIHC

Phytomedicine

Elucidating the underlying therapeutic mechanism of Feikang prescription on chronic obstructive pulmonary disease: insights from a comprehensive analysis

Authors - Xiaofang Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Roy (Verified Customer) (06-13-2024)

Works well to detect CBX5 in total and nuclear extracts of HeLa cells by WB (1/1000 dilution - Overnight incubation at 4°C).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa
FH

WEI (Verified Customer) (05-11-2022)

Specific bands at predicted size.

  • Applications: Western Blot
  • Cell Tissue Type: Mouse Heart
Loading...
||
New chat

Able

正在加载,请稍候...