Tested Applications
| Positive WB detected in | HeLa cells, human kidney tissue, K-562 cells, A431 cells, MCF-7 cells, HEK-293 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 11 publications below |
| IP | See 2 publications below |
| ChIP | See 1 publications below |
Product Information
11831-1-AP targets CBX5 in WB, IHC, IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2403 Product name: Recombinant human CBX5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC006821 Sequence: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS Predict reactive species |
| Full Name | chromobox homolog 5 (HP1 alpha homolog, Drosophila) |
| Calculated Molecular Weight | 191 aa, 22 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC006821 |
| Gene Symbol | CBX5 |
| Gene ID (NCBI) | 23468 |
| RRID | AB_2071356 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P45973 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443). This antibody is a rabbit polyclonal antibody raised against a full-length human HP1A protein ,and can reacts with the 28kd HP1A protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CBX5 antibody 11831-1-AP | Download protocol |
| IP protocol for CBX5 antibody 11831-1-AP | Download protocol |
| WB protocol for CBX5 antibody 11831-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Exp Med ZNF382 controls mouse neuropathic pain via silencer-based epigenetic inhibition of Cxcl13 in DRG neurons. | ||
Nat Commun The histone H3K9 methyltransferase SUV39H links SIRT1 repression to myocardial infarction. | ||
Cancer Res ZNF143-Mediated H3K9 Trimethylation Upregulates CDC6 by Activating MDIG in Hepatocellular Carcinoma. | ||
Sci Rep Exploration of common pathogenic genes between cerebral amyloid angiopathy and insomnia based on bioinformatics and experimental validation | ||
Asian Pac J Cancer Prev Triptolide Promotes Senescence of Prostate Cancer Cells Through Histone Methylation and Heterochromatin Formation | ||
Oncogene ZNF133 is a potent suppressor in breast carcinogenesis through dampening L1CAM, a driver for tumor progression |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Roy (Verified Customer) (06-13-2024) | Works well to detect CBX5 in total and nuclear extracts of HeLa cells by WB (1/1000 dilution - Overnight incubation at 4°C).
|
FH WEI (Verified Customer) (05-11-2022) | Specific bands at predicted size.
|























