CD134/OX40 Polyclonal antibody

• 

  WB analysis using 32621-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32621-1-AP (CD134/OX40 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32621-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32621-1-AP (CD134/OX40 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 32621-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 32621-1-AP (CD134/OX40 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD134/OX40 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32621-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CD134, Tnfrsf4, Ox40, OX40 antigen, OX40L receptor

---

Tested Applications

• Positive WB detected in: Con A treated rat splenocytes, Con A treated mouse splenocytes
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32621-1-AP targets CD134/OX40 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2936

  Product name: Recombinant Mouse CD134/OX40 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-211 aa of NM_011659.2

  Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP

• Full Name: tumor necrosis factor receptor superfamily, member 4
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_011659.2
• Gene Symbol: CD134
• Gene ID (NCBI): 22163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P47741
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD134 (OX40) is a member of the TNFR-superfamily of receptors. Predominantly expressed on activated T cells, CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule. CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmunity (PMID: 26215166). CD134 can interact with TRAF2, TRAF3, and TRAF5.