CD1c Polyclonal antibody

• 

  IHC staining of human tonsillitis using 28838-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28838-1-AP (CD1c antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 28838-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28838-1-AP (CD1C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD1c Polyclonal Antibody for IHC, ELISA

Cat No. 28838-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

BDCA1, CD1, CD1c molecule, R7, T-cell surface glycoprotein CD1c

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28838-1-AP targets CD1c in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29830

  Product name: Recombinant human CD1C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-118 aa of BC126467

  Sequence: NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKA

• Full Name: CD1c molecule
• Calculated Molecular Weight: 333 aa, 38 kDa
• GenBank Accession Number: BC126467
• Gene Symbol: CD1C
• Gene ID (NCBI): 911
• RRID: AB_3086090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29017
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD1c molecule (CD1c, also known as R7, CD1, CD1A, and BDCA1) is a member of the CD1 family of transmembrane glycoproteins, which is synthesized in the endoplasmic reticulum and expressed on the monocytes, marginal zone B cells in lymph nodes as well as peripheral blood (PMID: 23468110). The CD1 proteins belong to the family of major histocompatibility complex (MHC) class I-like proteins that present lipid-based antigens to T cells (PMID: 15032598; 23127489). CD1c shows interaction with both αβ or γδ T cells and mediates T cell responses against mycobacterium tuberculosis (PMID: 10727456; 10786796).