Use Able AI chat for product recommendations

CD24 Polyclonal antibody

CD24 Polyclonal Antibody for WB, ELISA

Cat No. 18330-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

CD24, CD24 molecule, CD24A, Signal transducer CD24

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, Raji cells, mouse spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18330-1-AP targets CD24 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11679

Product name: Recombinant human CD24 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-80 aa of BC007674

Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Predict reactive species
Full Name CD24 molecule
Calculated Molecular Weight8 kDa
Observed Molecular Weight 30-70 kDa
GenBank Accession NumberBC007674
Gene Symbol CD24
Gene ID (NCBI) 100133941
RRIDAB_10644293
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25063
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD24 is a cell surface signal transducing molecule, which is also known as a cluster of differentiation 24 or heat stable antigen CD24 (HSA) (PMID: 7959762). It is a sialoglycoprotein that is anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) link. Due to its cell surface localization, it contributes to a wide range of downstream signaling networks and has been shown to play crucial roles during neural development (PMID: 27993646) and the differentiation of various cell types. For example, it promotes antigen-dependent proliferation of B-cells, while preventing their terminal differentiation into antibody-producing cells (PMID: 11313396). CD24 may also play a role in apoptosis regulation, as cross-linking of this protein on the surface of neutrophils induces cell death, which seems to be defective in sepsis (PMID: 24501201). In addition, CD24 has been linked to negative regulation of the immune responses, particularly to danger-associated molecular patterns (DAMPs) (PMID: 24996822). 

What is the molecular weight of CD24?

According to NCBI, there are two known isoforms of CD24; the shorter 80 aa (8 kDa) isoform 1, which is considered a canonical sequence that has been experimentally validated, and a longer 120 aa (12,9 kDa) protein (PMIDs: 16344560, 15489334). Isoform 1 is further processed into a mature 32 aa form. Apart from these, 3 potential computationally mapped isoforms have been suggested. The CD24 gene locus is localized on chromosome 6, while other non-transcribed loci have been found on chromosomes 1, 15, 20, and Y (PMID: 7959762). 

What is the subcellular localization of CD24?

It is a cell surface protein that can act as an adhesion molecule. 

What is the tissue specificity of CD24?

As a rule, CD24 tends to be expressed at higher levels in progenitor cells and metabolically active cells and to a lesser extent in terminally differentiated cells (PMID: 25613900). CD24 is specifically expressed in a number of B-cell lines, granulocytes, and differentiating neuroblasts (PMID: 8753773, 12447971). The expression is lost when primary B-cells are induced to differentiate in antibody-forming cells. CD24 expression has also been linked with various malignancies: epithelial neoplasms (PMID:16164042), erythroleukemia cell and small cell lung carcinoma cell lines. For certain cancers it is considered a prognostic marker, usually associated with poor patient prognosis, e.g., colorectal cancer (PMID: 16166435) and ovarian cancer (PMID: 2368195). 

What is the involvement of CD24 in disease?

As mentioned before it is considered a prognostic marker in various malignancies. However, it is also clearly associated with multiple sclerosis (MS). Indeed, a single nucleotide polymorphism V57A has been associated with an over 2-fold increase in the susceptibility to MS and has been generally linked to a quicker progression of the disease in the general population (PMID: 14657362). 

What are the main roles of CD24?

Considering its expression patterns, it is clear why CD24 plays the most important roles in immune cells. It can be used as a marker for the differentiation of hematopoietic and neuronal cells, in addition to tissue and tumor stem cells (PMID: 12447971). CD24 has also been found to mediate apoptosis in precursor-B acute lymphoblastic leukemia cell lines in the pro-B and pre-B stages accompanying activation of multiple caspases (PMID: 12496407). It has also been shown to play a role in autoimmune responses, as CD24-deficient mice are resistant to autoimmune encephalomyelitis (PMID: 10791997). 


Publications

SpeciesApplicationTitle
humanWB

Nat Commun

Necroptosis enhances 'don't eat me' signal and induces macrophage extracellular traps to promote pancreatic cancer liver metastasis

Authors - Cheng-Yu Liao
humanWB

Cancer Lett

Cancer stem-like cell characteristics induced by EB virus-encoded LMP1 contribute to radioresistance in nasopharyngeal carcinoma by suppressing the p53-mediated apoptosis pathway.

Authors - Chang-Fu Yang
humanWB

Cancer Cell Int

SOCS6 promotes radiosensitivity and decreases cancer cell stemness in esophageal squamous cell carcinoma by regulating c-Kit ubiquitylation.

Authors - Xuanzi Sun
humanWB

Biomolecules

COL11A1-Driven Epithelial-Mesenchymal Transition and Stemness of Pancreatic Cancer Cells Induce Cell Migration and Invasion by Modulating the AKT/GSK-3β/Snail Pathway.

Authors - Hui Wang

Int J Oncol

PMID: 29956726

Authors - Pengfei Su
humanWB

Acta Biochim Biophys Sin (Shanghai)

miR-345 inhibits migration and stem-like cell phenotype in gastric cancer via inactivation of Rac1 by targeting EPS8.

Authors - Jieyun Zhang
Loading...
||
New chat

Able

正在加载,请稍候...