CD320 Polyclonal antibody

• 

  WB analysis using 10343-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10343-1-AP (CD320 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 10343-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10343-1-AP (CD320 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 10343-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10343-1-AP (CD320 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CD320 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10343-1-AP

Publications(10)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

8D6, 8D6A, FDC-signaling molecule 8D6, FDC-SM-8D6, TCblR

---

Tested Applications

• Positive WB detected in: HL-60 cells, K-562 cells, Raji cells, human placenta tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 5 publications below
• IF: See 4 publications below

Product Information

10343-1-AP targets CD320 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, canine, cat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0344

  Product name: Recombinant human CD320 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 84-280 aa of BC000668

  Sequence: SDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTS

• Full Name: CD320 molecule
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 60-70 kDa, 35-40 kDa
• GenBank Accession Number: BC000668
• Gene Symbol: CD320
• Gene ID (NCBI): 51293
• RRID: AB_2074223
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPF0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD320, also known as 8D6, 8D6A or TCblR, is a single-pass type I membrane protein containing 2 LDL-receptor class A domains. Expressed abundantly on follicular dendritic cells (FDCs), CD320 has been shown to enhance proliferation of germinal center (GC) B cells. It is the receptor for cellular uptake of transcobalamin-bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC). CD320 has a calculated molecular mass of 29 kDa. This antibody raised against 84-280aa of human CD320 protein detects bands at 35-40 kDa and 60-70 kDa. The aberrant mobility of the protein by SDS-PAGE is probably caused by extensive complex glycosylation (PMID: 18779389; 23415653).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
cat,canine	IHC	Oncotarget; Immunohistochemical quantification of the cobalamin transport protein, cell surface receptor and Ki-67 in naturally occurring canine and feline malignant tumors and in adjacent normal tissues.; Authors - Annette M Sysel
mouse	IF	Int J Biol Macromol; CD320 expression and apical membrane targeting in renal and intestinal epithelial cells.; Authors - Yue Chen
human	WB,IF	FASEB J; Identification of a novel mechanism for meso-tetra (4-carboxyphenyl) porphyrin (TCPP) uptake in cancer cells.; Authors - David J Elzi ; KD Validated
human	IHC	Anticancer Res; Immunohistochemical Quantification of the Vitamin B12 Transport Protein (TCII), Cell Surface Receptor (TCII-R) and Ki-67 in Human Tumor Xenografts.; Authors - Sysel Annette M AM
human	IHC	Heliyon; Secreted proteins in plasma and placenta as novel non-invasive biomarkers for intrahepatic cholestasis of pregnancy: A case-control study; Authors - Lingyan Chen
human	IF	Cell Rep; FTY720 requires vitamin B12-TCN2-CD320 signaling in astrocytes to reduce disease in an animal model of multiple sclerosis; Authors - Deepa Jonnalagadda

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (10-06-2025)

Good antibody for WB. Clean background

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse liver

CD320 Antibody Western Blot validation (1:1000 dilution) in mouse liver (Cat no:10343-1-AP)

FH

Joseph (Verified Customer) (09-17-2020)

We evaluated several CD320 antibodies but the Proteintech sequence provided better specificity and greater sensitivity to the CD320 protein target.

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:50 dilution human; 1:50 dilution canine; 1:25 dilution feline
• Cell Tissue Type: human, canine and feline malignant various