Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CD320 Polyclonal antibody

CD320 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF, ELISA

8D6, 8D6A, FDC-signaling molecule 8D6, FDC-SM-8D6, TCblR

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD320 in ?

Tested Applications

Positive WB detected inHL-60 cells, K-562 cells, Raji cells, human placenta tissue
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10343-1-AP targets CD320 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, canine, cat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0344

Product name: Recombinant human CD320 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 84-280 aa of BC000668

Sequence: SDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTS

Predict reactive species
Full Name CD320 molecule
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 60-70 kDa, 35-40 kDa
GenBank Accession NumberBC000668
Gene Symbol CD320
Gene ID (NCBI) 51293
RRIDAB_2074223
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NPF0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD320, also known as 8D6, 8D6A or TCblR, is a single-pass type I membrane protein containing 2 LDL-receptor class A domains. Expressed abundantly on follicular dendritic cells (FDCs), CD320 has been shown to enhance proliferation of germinal center (GC) B cells. It is the receptor for cellular uptake of transcobalamin-bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC). CD320 has a calculated molecular mass of 29 kDa. This antibody raised against 84-280aa of human CD320 protein detects bands at 35-40 kDa and 60-70 kDa. The aberrant mobility of the protein by SDS-PAGE is probably caused by extensive complex glycosylation (PMID: 18779389; 23415653).

Protocols

Product Specific Protocols
IHC protocol for CD320 antibody 10343-1-APDownload protocol
WB protocol for CD320 antibody 10343-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-CD320 antibody (Cat# 10343-1-AP) has 11 citations across journals including Cancer Letters, Cell Reports, Oncotarget, FASEB Journal, Molecular Pharmaceutics, Placenta, Computers in Biology and Medicine, International Journal of Biological Macromolecules, Discovery Oncology, Anticancer Research, and Heliyon. Research fields span cancer therapy, hepatocellular carcinoma, multiple sclerosis, preeclampsia, epithelial cell biology, veterinary oncology, and nutrient transport mechanisms.

SpeciesApplicationTitle
humanWB

Cancer Lett

Methionine restriction plus vitamin B12 antagonism overcomes methionine independence for cancer therapy.

Authors - Valentin Lacombe
mouseIF

Int J Biol Macromol

CD320 expression and apical membrane targeting in renal and intestinal epithelial cells.

Authors - Yue Chen
humanIHC

Comput Biol Med

Deciphering the heterogeneity and immunosuppressive function of regulatory T cells in osteosarcoma using single-cell RNA transcriptome

Authors - Debin Cheng
humanIF

Cell Rep

FTY720 requires vitamin B12-TCN2-CD320 signaling in astrocytes to reduce disease in an animal model of multiple sclerosis

Authors - Deepa Jonnalagadda
cat,canineIHC

Oncotarget

Immunohistochemical quantification of the cobalamin transport protein, cell surface receptor and Ki-67 in naturally occurring canine and feline malignant tumors and in adjacent normal tissues.

Authors - Annette M Sysel
rat

Mol Pharm

Investigation of Receptor-Mediated Cyanocobalamin (Vitamin B(12)) Transport across the Inner Blood-Retinal Barrier Using Fluorescence-Labeled Cyanocobalamin

Authors - Yuri Kinoshita

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers gave this antibody a perfect 5-star rating. One user found it performed well in Western Blot on mouse liver tissue at 1:1000 dilution, noting clean background. The other, who evaluated multiple CD320 antibodies for Immunohistochemistry across human, canine, and feline tissues, reported that this Proteintech antibody provided superior specificity and sensitivity compared to alternatives they tested. Overall, users highlight strong performance and reliable results in their applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (10-06-2025)

Good antibody for WB. Clean background

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse liver
CD320 Antibody Western Blot validation (1:1000 dilution) in mouse liver (Cat no:10343-1-AP)

Joseph (Verified Customer) (09-17-2020)

We evaluated several CD320 antibodies but the Proteintech sequence provided better specificity and greater sensitivity to the CD320 protein target.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:50 dilution human; 1:50 dilution canine; 1:25 dilution feline
  • Cell Tissue Type: human, canine and feline malignant various
Loading...
||
New chat

Able™

正在加载,请稍候...