Tested Applications
| Positive WB detected in | HL-60 cells, K-562 cells, Raji cells, human placenta tissue |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10343-1-AP targets CD320 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, canine, cat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0344 Product name: Recombinant human CD320 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 84-280 aa of BC000668 Sequence: SDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTS Predict reactive species |
| Full Name | CD320 molecule |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 60-70 kDa, 35-40 kDa |
| GenBank Accession Number | BC000668 |
| Gene Symbol | CD320 |
| Gene ID (NCBI) | 51293 |
| RRID | AB_2074223 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPF0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD320, also known as 8D6, 8D6A or TCblR, is a single-pass type I membrane protein containing 2 LDL-receptor class A domains. Expressed abundantly on follicular dendritic cells (FDCs), CD320 has been shown to enhance proliferation of germinal center (GC) B cells. It is the receptor for cellular uptake of transcobalamin-bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC). CD320 has a calculated molecular mass of 29 kDa. This antibody raised against 84-280aa of human CD320 protein detects bands at 35-40 kDa and 60-70 kDa. The aberrant mobility of the protein by SDS-PAGE is probably caused by extensive complex glycosylation (PMID: 18779389; 23415653).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD320 antibody 10343-1-AP | Download protocol |
| WB protocol for CD320 antibody 10343-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CD320 antibody (Cat# 10343-1-AP) has 11 citations across journals including Cancer Letters, Cell Reports, Oncotarget, FASEB Journal, Molecular Pharmaceutics, Placenta, Computers in Biology and Medicine, International Journal of Biological Macromolecules, Discovery Oncology, Anticancer Research, and Heliyon. Research fields span cancer therapy, hepatocellular carcinoma, multiple sclerosis, preeclampsia, epithelial cell biology, veterinary oncology, and nutrient transport mechanisms.
| Species | Application | Title |
|---|---|---|
Cancer Lett Methionine restriction plus vitamin B12 antagonism overcomes methionine independence for cancer therapy. | ||
Int J Biol Macromol CD320 expression and apical membrane targeting in renal and intestinal epithelial cells. | ||
Comput Biol Med Deciphering the heterogeneity and immunosuppressive function of regulatory T cells in osteosarcoma using single-cell RNA transcriptome | ||
Cell Rep FTY720 requires vitamin B12-TCN2-CD320 signaling in astrocytes to reduce disease in an animal model of multiple sclerosis | ||
Oncotarget Immunohistochemical quantification of the cobalamin transport protein, cell surface receptor and Ki-67 in naturally occurring canine and feline malignant tumors and in adjacent normal tissues. | ||
Mol Pharm Investigation of Receptor-Mediated Cyanocobalamin (Vitamin B(12)) Transport across the Inner Blood-Retinal Barrier Using Fluorescence-Labeled Cyanocobalamin |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating. One user found it performed well in Western Blot on mouse liver tissue at 1:1000 dilution, noting clean background. The other, who evaluated multiple CD320 antibodies for Immunohistochemistry across human, canine, and feline tissues, reported that this Proteintech antibody provided superior specificity and sensitivity compared to alternatives they tested. Overall, users highlight strong performance and reliable results in their applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (10-06-2025) | Good antibody for WB. Clean background
 |
Joseph (Verified Customer) (09-17-2020) | We evaluated several CD320 antibodies but the Proteintech sequence provided better specificity and greater sensitivity to the CD320 protein target.
|
