• Featured Product
  • KD/KO Validated

CD63 Polyclonal antibody

CD63 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 25682-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IHC, IF/ICC, IF-P, IP, ChIP, ELISA

CD 63, CD63 antigen, Limp1, Lysosomal-associated membrane protein 3, Lysosome integral membrane protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman urine exosomes tissue, A375 cells, human serum exosomes, THP-1 cells, human peripheral blood platelets
Positive IHC detected inhuman malignant melanoma tissue, human lymphoma tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman malignant melanoma tissue
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:40000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25682-1-AP targets CD63 in WB, IHC, IF/ICC, IF-P, IP, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit, monkey, hamster, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19690

Product name: Recombinant human CD63 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-209 aa of BC002349

Sequence: GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA

Predict reactive species
Full Name CD63 molecule
Calculated Molecular Weight 26 kDa
Observed Molecular Weight30-60 kDa
GenBank Accession NumberBC002349
Gene Symbol CD63
Gene ID (NCBI) 967
RRIDAB_2783831
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08962
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it as a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.

Protocols

Product Specific Protocols
IF protocol for CD63 antibody 25682-1-APDownload protocol
IHC protocol for CD63 antibody 25682-1-APDownload protocol
WB protocol for CD63 antibody 25682-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

In vivo self-assembled small RNAs as a new generation of RNAi therapeutics.

Authors - Zheng Fu
humanWB

ACS Nano

Engineering Extracellular Vesicles Restore the Impaired Cellular Uptake and Attenuate Intervertebral Disc Degeneration.

Authors - Zhiwei Liao
WB

Nat Commun

Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes

Authors - Wenkai Wang

Transl Neurodegener

Abnormal α-synuclein binds to synaptotagmin 13, impairing extracellular vesicle release in synucleinopathies

Authors - Yasuo Miki
humanWB

Adv Sci (Weinh)

Tβ4-Engineered ADSC Extracellular Vesicles Rescue Cell Senescence Through Separable Microneedle Patches for Diabetic Wound Healing

Authors - Youjun Ding
humanWB

Adv Sci (Weinh)

Astrocyte-Derived Extracellular Vesicular miR-143-3p Dampens Autophagic Degradation of Endothelial Adhesion Molecules and Promotes Neutrophil Transendothelial Migration after Acute Brain Injury

Authors - Xun Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sonam (Verified Customer) (11-17-2025)

Works well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: cancer cell
FH

Federica (Verified Customer) (11-30-2023)

I used a Leica Bond Max on a healthy Tonsil tissue. Antigen Retrival ER2 95C for 30min

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Tonsil
CD63 Antibody Immunohistochemistry validation (1:1000 dilution) in Tonsil (Cat no:25682-1-AP)
FH

Nydia (Verified Customer) (06-11-2022)

The HeLa cells as well as Lamp1-expressing stem cells used in the immunostaining were transfected or alternatively transfected by splitting the cells later on the glass coverslips. In order to increase cell spreading and adhesion, the coverslips used were acid washed and treated with fibronectin. Afterwards, the cells were fixed with 4% PFA, permeabilized with 0.2% Triton X-100 in phosphate- buffered saline (PBS) for 10 minutes and for 1 hour the cells were blocked with 5% BSA in PBS. Then overnight, at 4 degrees Celsius, the primary antibodies were added followed by a wash with PBS 3 times.

  • Applications: Cell culture
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa cells
CD63 Antibody Cell culture validation (1:1000 dilution) in HeLa cells (Cat no:25682-1-AP)
FH

Guorong (Verified Customer) (03-22-2022)

Smears between 30 and 60 kDa was detected

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: ARPE-19
CD63 Antibody Western Blot validation (1:500 dilution) in ARPE-19 (Cat no:25682-1-AP)
FH

David (Verified Customer) (03-30-2020)

Used for both SH-SY5Y lysate and exosomes/ extracellular vesicles. Very good signal in lysates (could be used at much higher dilution). Also good signal in exosomes, which are notoriously difficult to assess by immunoblot. Very impressive results compared to other markers.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: SH-SY5Y
Loading...
||
New chat

Able

正在加载,请稍候...