Use Able AI chat for product recommendations

CD7 Monoclonal antibody

CD7 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60209-2-Ig
Clone No.2A4E6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, ELISA

2A4E6, CD7 molecule, GP40, LEU-9, T cell antigen CD7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HepG2 cells, HuH-7 cells, MOLT-4 cells
Positive IHC detected inhuman tonsillitis tissue, human appendicitis tissue, human lymphoma tissue, mouse thymus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60209-2-Ig targets CD7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1805

Product name: Recombinant human CD7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-240 aa of BC009293

Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ

Predict reactive species
Full Name CD7 molecule
Calculated Molecular Weight 240 aa, 25 kDa
Observed Molecular Weight 34-36 kDa
GenBank Accession NumberBC009293
Gene Symbol CD7
Gene ID (NCBI) 924
ENSEMBL Gene IDENSG00000173762
RRIDAB_2881355
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP09564
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512).

Protocols

Product Specific Protocols
WB protocol for CD7 antibody 60209-2-IgDownload protocol
IHC protocol for CD7 antibody 60209-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...