Tested Applications
| Positive WB detected in | HCT 116 cells, HEK-293 cells, HeLa cells, L02 cells, HEK-293-derived exosomes |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human endometrial cancer tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human ovary cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20597-1-AP targets CD9 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, chicken, goat, bat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14546 Product name: Recombinant human CD9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI Predict reactive species |
| Full Name | CD9 molecule |
| Calculated Molecular Weight | 228 aa, 25 kDa |
| Observed Molecular Weight | 23-30 kDa |
| GenBank Accession Number | BC011988 |
| Gene Symbol | CD9 |
| Gene ID (NCBI) | 928 |
| RRID | AB_2878706 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21926 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, it may be due to the difference of glycosylations (PMID: 8701996).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD9 antibody 20597-1-AP | Download protocol |
| IHC protocol for CD9 antibody 20597-1-AP | Download protocol |
| WB protocol for CD9 antibody 20597-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD9 Polyclonal antibody (Cat# 20597-1-AP) has accumulated 529 citations. Publications appear in prestigious journals including Nature Communications, Cell Metabolism, Nature Methods, Gastroenterology, Molecular Cancer, Advanced Science, Biomaterials, Theranostics, Journal of Extracellular Vesicles, and Stem Cell Research & Therapy. Research fields encompass extracellular vesicle/exosome biology, oncology, wound healing, neurodegeneration, fibrosis, diabetes, cardiovascular disease, bone and tissue regeneration, and immunology. Western blot is the predominant cited application.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis | ||
Mol Cancer CD103-positive CSC exosome promotes EMT of clear cell renal cell carcinoma: role of remote MiR-19b-3p. | ||
Mol Cancer LncRNA NEAT1 promotes immunosuppression in gastric cancer under endoplasmic reticulum stress by maintaining the M(6)A methylation of SEMA3A in CAFs. | ||
Cell Metab The foam cell-derived exosomes exacerbate ischemic white matter injury via transmitting metabolic defects to microglia | ||
Cell Metab Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining | ||
Reviews
What customers say
The product has one review, rated 5 stars. The reviewer used it for Western Blot at a 1:3000 dilution on U266 cells and described it as a good antibody for Western applications. Overall, the feedback is positive, indicating reliable performance for WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
lu (Verified Customer) (12-04-2025) | good antibody for western
|
