CHMP1A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CHMP1A Polyclonal antibody (15761-1-AP)

• Featured Product
• KD/KO Validated

CHMP1A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15761-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

KIAA0047, hVps46-1, hVps46 1, Chromatin-modifying protein 1a, chromatin modifying protein 1A

• 

  WB analysis of HEK-293 using 15761-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 15761-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15761-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 15761-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 15761-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 15761-1-AP

  IP result of anti-CHMP1A (IP:15761-1-AP, 3ug; Detection:15761-1-AP 1:500) with HEK-293 cells lysate 880ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15761-1-AP (CHMP1A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15761-1-AP (CHMP1A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15761-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 15761-1-AP (CHMP1A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CHMP1A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse lung tissue, HeLa cells, A431 cells, mouse kidney tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse brain tissue, human lung tissue, mouse testis tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15761-1-AP targets CHMP1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8389

  Product name: Recombinant human CHMP1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC007527

  Sequence: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN

• Full Name: chromatin modifying protein 1A
• Calculated Molecular Weight: 196 aa, 22 kDa
• Observed Molecular Weight: 33 kDa, 25 kDa
• GenBank Accession Number: BC007527
• Gene Symbol: CHMP1A
• Gene ID (NCBI): 5119
• RRID: AB_2229399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD42
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Charged multivesicular body protein 1A (CHMP1A), also known as chromatin modifying protein 1A, is a member of the ESCRT-III (endosomal sorting complex required for transport III) complex which is involved in degradation of internalized transmembrane receptor proteins and formation of multivesicular bodies (MVBs) (PMID: 16730941). CHMP1A has both nuclear and cytoplasmic distributions (PMID: 11559748; 11559747). Subcellular localization of CHMP1A seems to vary depending on the cell type (PMID: 23023333). CHMP1A is required for MVBs formation and has a role in stable gene silencing within the nucleus. Besides, the tumor suppressor role of CHMP1A has also been reported (PMID: 18787405; 22261332).

Publications

What published studies show

The CHMP1A Polyclonal antibody (catalog number 15761-1-AP) has 14 citations. These appear in journals including Nature Cell Biology, Nature Communications, Autophagy, Cell Reports, Journal of Cell Biology, Journal of Extracellular Vesicles, Current Biology, Biochemical and Biophysical Research Communications, Methods in Molecular Biology, and bioRxiv. The research fields span ESCRT-III complex biology, exosome and extracellular vesicle formation, autophagy and mitophagy, cell membrane repair, cytokinetic abscission, ferroptosis, hepatocellular carcinoma, and T cell leukemia.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Cell Biol; Endosomal membrane tension regulates ESCRT-III-dependent intra-lumenal vesicle formation.; Authors - Vincent Mercier
human	WB	J Extracell Vesicles; Accessory ESCRT-III proteins are conserved and selective regulators of Rab11a-exosome formation; Authors - Pauline P Marie
		Autophagy; Classical swine fever virus hijacks ESCRT-III and VPS4A to promote phagophore closure for accelerating mitophagy.; Authors - Yan Cheng
human	WB	Autophagy; ATP6V1D drives hepatocellular carcinoma stemness and progression via both lysosome acidification-dependent and -independent mechanisms; Authors - Zhijie Xu
mouse	WB,IF	Nat Commun; A single genetic locus controls both expression of DPEP1/CHMP1A and kidney disease development via ferroptosis.; Authors - Yuting Guan ; KO Validated
mouse	WB	Nat Commun; Mechanism of Ca²⁺-triggered ESCRT assembly and regulation of cell membrane repair.; Authors - Luana L Scheffer