CHMP1A Polyclonal antibody

• 

  WB analysis of HEK-293 using 15761-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15761-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 15761-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 15761-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 15761-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 15761-1-AP (CHMP1A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 15761-1-AP

  IP result of anti-CHMP1A (IP:15761-1-AP, 3ug; Detection:15761-1-AP 1:500) with HEK-293 cells lysate 880ug.

• 

  IHC staining of mouse brain using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15761-1-AP (CHMP1A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15761-1-AP (CHMP1A antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 15761-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15761-1-AP (CHMP1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 15761-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 15761-1-AP (CHMP1A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CHMP1A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15761-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

KIAA0047, hVps46-1, hVps46 1, Chromatin-modifying protein 1a, chromatin modifying protein 1A

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse lung tissue, HeLa cells, A431 cells, mouse kidney tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse brain tissue, human lung tissue, mouse testis tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 7 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

15761-1-AP targets CHMP1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8389

  Product name: Recombinant human CHMP1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC007527

  Sequence: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN

• Full Name: chromatin modifying protein 1A
• Calculated Molecular Weight: 196 aa, 22 kDa
• Observed Molecular Weight: 33 kDa, 25 kDa
• GenBank Accession Number: BC007527
• Gene Symbol: CHMP1A
• Gene ID (NCBI): 5119
• RRID: AB_2229399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD42
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Charged multivesicular body protein 1A (CHMP1A), also known as chromatin modifying protein 1A, is a member of the ESCRT-III (endosomal sorting complex required for transport III) complex which is involved in degradation of internalized transmembrane receptor proteins and formation of multivesicular bodies (MVBs) (PMID: 16730941). CHMP1A has both nuclear and cytoplasmic distributions (PMID: 11559748; 11559747). Subcellular localization of CHMP1A seems to vary depending on the cell type (PMID: 23023333). CHMP1A is required for MVBs formation and has a role in stable gene silencing within the nucleus. Besides, the tumor suppressor role of CHMP1A has also been reported (PMID: 18787405; 22261332).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Cell Biol; Endosomal membrane tension regulates ESCRT-III-dependent intra-lumenal vesicle formation.; Authors - Vincent Mercier
human	WB	J Extracell Vesicles; Accessory ESCRT-III proteins are conserved and selective regulators of Rab11a-exosome formation; Authors - Pauline P Marie
mouse	WB,IF	Nat Commun; A single genetic locus controls both expression of DPEP1/CHMP1A and kidney disease development via ferroptosis.; Authors - Yuting Guan ; KO Validated
mouse	WB	Nat Commun; Mechanism of Ca²⁺-triggered ESCRT assembly and regulation of cell membrane repair.; Authors - Luana L Scheffer
		J Cell Biol; ALIX- and ESCRT-III-dependent sorting of tetraspanins to exosomes.; Authors - Jorge Larios
human,mouse	IHC	Cell Rep; The ESCRT-III Protein CHMP1A Mediates Secretion of Sonic Hedgehog on a Distinctive Subtype of Extracellular Vesicles.; Authors - Michael E Coulter ; KO Validated