Tested Applications
| Positive WB detected in | mouse testis tissue |
| Positive IP detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14102-1-AP targets CNOT7 in WB, IHC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5235 Product name: Recombinant human CNOT7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-285 aa of BC060852 Sequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS Predict reactive species |
| Full Name | CCR4-NOT transcription complex, subunit 7 |
| Calculated Molecular Weight | 285 aa, 33 kDa |
| Observed Molecular Weight | 33-35 kDa |
| GenBank Accession Number | BC060852 |
| Gene Symbol | CNOT7 |
| Gene ID (NCBI) | 29883 |
| RRID | AB_2245087 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UIV1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cnot7, Ccr4-Not complex 7, is a component of CCR4-NOT complex and known to be a transcription factor and a modulator of mRNA degradation in yeast. Mammalian Cnot7 interacts with Tob and its family members, which is known as an inhibitor of BMP signaling through interfering with the Smad system and is involved in bone metabolism [PMID:17451368]. It is one of at least 8 subunits that make up the CCR4-Not transcription complex, which is involved in negative regulation of the pol II directed transcription in yeast24 and may be involved in global gene regulation by modulation of TATAA-binding protein (TBP) activity [PMID:10880468].
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for CNOT7 antibody 14102-1-AP | Download protocol |
| WB protocol for CNOT7 antibody 14102-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CNOT7 Polyclonal Antibody (Cat# 14102-1-AP) has 12 citations spanning journals including Nature, Nature Communications, Molecular Cell, Nucleic Acids Research, Cell Death & Disease, Cell Reports, and others. Research fields covered include CCR4-NOT complex biology, mRNA degradation and translation, epigenetic regulation, stem cell maintenance, cancer (colorectal, kidney), radiation resistance, lipid metabolism in NAFLD, HIV repression, and RNA-binding protein function. Applications cited include WB, IP, IHC, and RIP, primarily in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nature DND1 maintains germline stem cells via recruitment of the CCR4-NOT complex to target mRNAs. | ||
Nat Commun TASOR epigenetic repressor cooperates with a CNOT1 RNA degradation pathway to repress HIV. | ||
Mol Cell Argonaute-miRNA Complexes Silence Target mRNAs in the Nucleus of Mammalian Stem Cells. | ||
Cell Death Dis CNOT7 facilitates radiation resistance in colorectal cancer through TRIM21/XRCC6-mediated non-homologous end joining repair.
| ||
Int J Mol Med B cell translocation gene 1 reduces the biological outcome of kidney cancer through induction of cell proliferation, cell cycle arrest, cell apoptosis and cell metastasis. |
Reviews
What customers say
Both reviewers rated this antibody 5 stars for Western Blot at a 1/1000 dilution. One user reported a clear, specific band at the expected molecular weight. The other confirmed reliable detection of CNOT7 in HeLa cells, validated by siRNA-mediated knockdown, using an overnight incubation at 4°C. Overall, users find the antibody specific, sensitive, and well-suited for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maria (Verified Customer) (11-09-2025) | Works very well in WB, clear and specific band at the expected size.
|
Roy (Verified Customer) (06-13-2024) | Works well to detect CNOT7 (validated through siRNA-mediated KD of CNOT7 - 1/1000 dilution with an overnight incubation at 4°C).
|
