COLEC11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COLEC11 Polyclonal antibody (15269-1-AP)

COLEC11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15269-1-AP

Publications(8)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Collectin-11, UNQ596/PRO1182, Collectin 11, CL-K1, CLK1

• 

  WB analysis of mouse liver using 15269-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15269-1-AP (COLEC11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human plasma using 15269-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 15269-1-AP (COLEC11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 15269-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15269-1-AP (COLEC11 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 15269-1-AP

  IP result of anti-COLEC11 (IP:15269-1-AP, 4ug; Detection:15269-1-AP 1:500) with mouse liver tissue lysate 6400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15269-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15269-1-AP (COLEC11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15269-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15269-1-AP (COLEC11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of ATCD5 cells using 15269-1-AP

  IF result (confocal image) of CL-K1 in ATCD5 cell show Golgi localization from Prof. Philip L. Beales.

---

Tested Applications

• Positive WB detected in: mouse liver tissue, human plasma
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: ATCD5 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15269-1-AP targets COLEC11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7374

  Product name: Recombinant human COLEC11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-271 aa of BC000078

  Sequence: SLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

• Full Name: collectin sub-family member 11
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC000078
• Gene Symbol: COLEC11
• Gene ID (NCBI): 78989
• RRID: AB_10732940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWP8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COLEC11, also named as CL-K1 and Collectin-11, belongs to the COLEC10/COLEC11 family. It is a lectin that binds to various sugars: fucose > mannose. It does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. COLEC11 binds to LPS. COLEC11 and MASP1 are two genes in the lectin complement pathway, they are mutated in 3MC syndrome, implicating this diverse inflammation-chemotaxis cascade in the etiology of human developmental disorders. COLEC11 serves as a guidance cue for neural crest cell migration.(PMID:21258343)

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC,IF	Nat Genet; Mutations in lectin complement pathway genes COLEC11 and MASP1 cause 3MC syndrome.; Authors - Rooryck Caroline C
human	WB,IF	Clin J Am Soc Nephrol; Collectin11 and Complement Activation in IgA Nephropathy.; Authors - Min Wei
mouse	WB	Front Immunol; Development of a Quantitative Assay for the Characterization of Human Collectin-11 (CL-11, CL-K1).; Authors - Rafael Bayarri-Olmos
human	WB	J Immunol; Heterocomplex Formation between MBL/Ficolin/CL-11-Associated Serine Protease-1 and -3 and MBL/Ficolin/CL-11-Associated Protein-1.; Authors - Anne Rosbjerg
human	FC	J Innate Immun; Collectin-11/MASP Complex Formation Triggers Activation of the Lectin Complement Pathway - The Fifth Lectin Pathway Initiation Complex.; Authors - Ma Ying Jie YJ
human	WB	Clin Proteomics; iTRAQ plasma proteomics analysis for candidate biomarkers of type 2 incipient diabetic nephropathy.; Authors - Hongmei Lu

Reviews

4.0 out of 5

2 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Christopher (Verified Customer) (08-28-2019)

Antibody works for identification of recombinant CL-11 well however multiple bands appears on cell lysates.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human PTECs

mark (Verified Customer) (08-13-2019)

Consitent fro WB but binds non CL-11 in cell lysatesFor immunohistochemistry/immunoflourescence binds CL-11 consistently but also has off target effects (eg in CL-11 KO mice)

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence,
• Primary Antibody Dilution: 1:1000 for WB, 1:100 for Immuno
• Cell Tissue Type: mouse cell culture, mouse kidney, mouse embryos, human kidney