• Featured Product
  • KD/KO Validated

CSN2 Polyclonal antibody

CSN2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10969-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

COPS2, JAB1-containing signalosome subunit 2, COPS2/TRIP15, COPS 2, Alien homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293T cells, HEK-293 cells, mouse brain tissue, NIH/3T3 cells, mouse kidney tissue
Positive IP detected inNIH/3T3 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10969-2-AP targets CSN2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1415

Product name: Recombinant human COPS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-443 aa of BC012629

Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Predict reactive species
Full Name COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC012629
Gene Symbol COPS2
Gene ID (NCBI) 9318
RRIDAB_2276346
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP61201
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. (refer to UniProt) Catalog#10969-2-AP is a rabbit polyclonal antibody raised against the full-length of human COPS2. The MW of this protein is 52 kDa, and this antibody specially recognises the 52 kDa protein.

Protocols

Product Specific Protocols
IF protocol for CSN2 antibody 10969-2-APDownload protocol
IHC protocol for CSN2 antibody 10969-2-APDownload protocol
IP protocol for CSN2 antibody 10969-2-APDownload protocol
WB protocol for CSN2 antibody 10969-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

Glucose-induced CRL4COP1-p53 axis amplifies glycometabolism to drive tumorigenesis

Authors - Yang Su
mouseWB

Nat Commun

IP6-assisted CSN-COP1 competition regulates a CRL4-ETV5 proteolytic checkpoint to safeguard glucose-induced insulin secretion.

Authors - Hong Lin
  • KD Validated
humanWB

Proc Natl Acad Sci U S A

Inositol hexakisphosphate kinase-1 mediates assembly/disassembly of the CRL4-signalosome complex to regulate DNA repair and cell death.

Authors - Feng Rao
humanWB

Proc Natl Acad Sci U S A

Inositol hexakisphosphate (IP6) generated by IP5K mediates cullin-COP9 signalosome interactions and CRL function.

Authors - Paul C Scherer
humanWB

Proc Natl Acad Sci U S A

Basis for metabolite-dependent Cullin-RING ligase deneddylation by the COP9 signalosome.

Authors - Hong Lin
humanWB

iScience

Using brain cell-type-specific protein interactomes to interpret neurodevelopmental genetic signals in schizophrenia

Authors - Yu-Han H Hsu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Resha (Verified Customer) (11-01-2023)

In 20ug of total protein, 1:1000 dilution of anti-COPS2 antibody gave clear band of 52kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa cells
Loading...
||
New chat Able
正在加载,请稍候...