Tested Applications
| Positive WB detected in | HeLa cells, HEK-293T cells, HEK-293 cells, mouse brain tissue, NIH/3T3 cells, mouse kidney tissue |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
10969-2-AP targets CSN2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1415 Product name: Recombinant human COPS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-443 aa of BC012629 Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA Predict reactive species |
| Full Name | COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC012629 |
| Gene Symbol | COPS2 |
| Gene ID (NCBI) | 9318 |
| RRID | AB_2276346 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61201 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. (refer to UniProt) Catalog#10969-2-AP is a rabbit polyclonal antibody raised against the full-length of human COPS2. The MW of this protein is 52 kDa, and this antibody specially recognises the 52 kDa protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CSN2 antibody 10969-2-AP | Download protocol |
| IHC protocol for CSN2 antibody 10969-2-AP | Download protocol |
| IP protocol for CSN2 antibody 10969-2-AP | Download protocol |
| WB protocol for CSN2 antibody 10969-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell Glucose-induced CRL4COP1-p53 axis amplifies glycometabolism to drive tumorigenesis | ||
Nat Commun IP6-assisted CSN-COP1 competition regulates a CRL4-ETV5 proteolytic checkpoint to safeguard glucose-induced insulin secretion.
| ||
Proc Natl Acad Sci U S A Inositol hexakisphosphate kinase-1 mediates assembly/disassembly of the CRL4-signalosome complex to regulate DNA repair and cell death. | ||
Proc Natl Acad Sci U S A Inositol hexakisphosphate (IP6) generated by IP5K mediates cullin-COP9 signalosome interactions and CRL function. | ||
Proc Natl Acad Sci U S A Basis for metabolite-dependent Cullin-RING ligase deneddylation by the COP9 signalosome. | ||
iScience Using brain cell-type-specific protein interactomes to interpret neurodevelopmental genetic signals in schizophrenia |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Resha (Verified Customer) (11-01-2023) | In 20ug of total protein, 1:1000 dilution of anti-COPS2 antibody gave clear band of 52kDa.
|

















