"COX4I2 Antibodies" Comparison
View side-by-side comparison of COX4I2 antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | HepG2 cells, A375 cells, human brain tissue, MCF-7 cells, mouse heart tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11463-1-AP targets COX4I2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1987 Product name: Recombinant human COX4I2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC057779 Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK Predict reactive species |
| Full Name | cytochrome c oxidase subunit IV isoform 2 (lung) |
| Calculated Molecular Weight | 171 aa, 20 kDa |
| Observed Molecular Weight | 17-18 kDa |
| GenBank Accession Number | BC057779 |
| Gene Symbol | COX4I2 |
| Gene ID (NCBI) | 84701 |
| RRID | AB_2085287 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96KJ9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX4I2, also named as COX4L2 and COXIV-2, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COXIV(cytochrome c oxidase IV) has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. This antibody was generated against full length COX4I2 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX4I2 antibody 11463-1-AP | Download protocol |
| IHC protocol for COX4I2 antibody 11463-1-AP | Download protocol |
| IP protocol for COX4I2 antibody 11463-1-AP | Download protocol |
| WB protocol for COX4I2 antibody 11463-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-COX4I1 (Cat# 11463-1-AP) has 22 citations across journals including Nature Communications, Cancer Discovery, Science Advances, Free Radical Biology and Medicine, Cell Reports, Oncotarget, and Journal of Biological Chemistry. Research fields span mitochondrial biology, oxidative stress, hypoxia signaling, cancer (glioblastoma, renal cell carcinoma, prostate cancer), cardiovascular disease, neurodegeneration, ferroptosis, and diabetes. Applications include WB, IHC, and IF in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Cancer Discov Copper Drives Remodeling of Metabolic State and Progression of Clear Cell Renal Cell Carcinoma | ||
Nat Commun Hif1α-dependent mitochondrial acute O2 sensing and signaling to myocyte Ca2+ channels mediate arterial hypoxic vasodilation | ||
Sci Adv Putative PINK1/Parkin activators lower the threshold for mitophagy by sensitizing cells to mitochondrial stress | ||
Basic Res Cardiol Comparison of the stage-dependent mitochondrial changes in response to pressure overload between the diseased right and left ventricle in the rat | ||
Antioxidants (Basel) Cytochrome c Oxidase Subunit COX4-1 Reprograms Erastin-Induced Cell Death from Ferroptosis to Apoptosis: A Transmitochondrial Study. | ||
Free Radic Biol Med Differentiation of SH-SY5Y cells to a neuronal phenotype changes cellular bioenergetics and the response to oxidative stress. |
Reviews
What customers say
The single review for this product is highly positive, rated 5 out of 5. The reviewer used it for Western Blot at a 1:500 dilution on HTR cells and reported excellent results with clear bands. Overall, the feedback indicates strong performance and reliable band quality in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vignesh (Verified Customer) (09-19-2025) | The results are excellent, bands are clear
|
