Filter:
  • Western Blot (WB) analysis of various lysates using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis using 11463-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at 4 degree celsius over night.

  • Western Blot (WB) analysis of various lysates using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis using 11463-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HepG2 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of HepG2 using 11463-1-AP

    HepG2 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of human lung tissue using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of human lung using 11463-1-AP

    human lung tissue were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of human brain tissue using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of human brain using 11463-1-AP

    human brain tissue were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of MCF-7 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of MCF-7 using 11463-1-AP

    MCF7 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of A375 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of A375 using 11463-1-AP

    A375 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of MCF-7 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of MCF-7 using 11463-1-AP

    MCF7 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of human brain tissue using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of human brain using 11463-1-AP

    human brain tissue were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of human heart tissue using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of human heart using 11463-1-AP

    human heart tissue were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment using COX4I2 Polyclonal antibody (11463-1-AP)

    IP experiment using 11463-1-AP

    IP result of anti-COX4I2 (11463-1-AP for IP and Detection) with HepG2 cell lysate.

  • Immunoprecipitation (IP) experiment of HepG2 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    IP experiment of HepG2 using 11463-1-AP

    IP result of anti-COX4I2 (IP:11463-1-AP, 3ug; Detection:11463-1-AP 1:1000) with HepG2 cells lysate 8000ug.

  • Immunohistochemistry (IHC) staining of human ovary tumor tissue using COX4I2 Polyclonal antibody (11463-1-AP)

    IHC staining of human ovary tumor using 11463-1-AP

    Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11463-1-AP (COX4I2 antibody) at dilution of 1:50 (under 10x lens).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using COX4I2 Polyclonal antibody (11463-1-AP)

    IF Staining of HeLa using 11463-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX4I2 antibody (11463-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    IF Staining of HepG2 using 11463-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COX4I2 antibody (11463-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

"COX4I2 Antibodies" Comparison

View side-by-side comparison of COX4I2 antibodies from other vendors to find the one that best suits your research needs.
  • Featured Product
  • KD/KO Validated

COX4I2 Polyclonal antibody

COX4I2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11463-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

COX IV 2, COX IV-2, COX4, COX4 2, COX4B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, A375 cells, human brain tissue, human heart tissue, human lung tissue, MCF-7 cells, mouse heart tissue, rat heart tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11463-1-AP targets COX4I2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1987

Product name: Recombinant human COX4I2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC057779

Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

Predict reactive species
Full Name cytochrome c oxidase subunit IV isoform 2 (lung)
Calculated Molecular Weight 171 aa, 20 kDa
Observed Molecular Weight 17-18 kDa
GenBank Accession NumberBC057779
Gene Symbol COX4I2
Gene ID (NCBI) 84701
RRIDAB_2085287
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96KJ9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I2, also named as COX4L2 and COXIV-2, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COXIV(cytochrome c oxidase IV) has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. This antibody was generated against full length COX4I2 protein.

Protocols

Product Specific Protocols
IF protocol for COX4I2 antibody 11463-1-APDownload protocol
IHC protocol for COX4I2 antibody 11463-1-APDownload protocol
IP protocol for COX4I2 antibody 11463-1-APDownload protocol
WB protocol for COX4I2 antibody 11463-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Rep

Defective Mitochondrial Cardiolipin Remodeling Dampens HIF-1α Expression in Hypoxia.

Authors - Arpita Chowdhury
humanWB

Oncotarget

Nuclear-encoded cytochrome c oxidase subunit 4 regulates BMI1 expression and determines proliferative capacity of high-grade gliomas.

Authors - Claudia R Oliva
  • KD Validated
mouseIF

Sci Signal

Acute O2 sensing through HIF2α-dependent expression of atypical cytochrome oxidase subunits in arterial chemoreceptors.

Authors - Alejandro Moreno-Domínguez
  • KO Validated
humanWB

Free Radic Biol Med

Cytochrome c oxidase mediates labile iron level and radioresistance in glioblastoma.

Authors - Md Yousuf Ali
humanWB

Bioconjug Chem

GnRH-Gemcitabine Conjugates for the Treatment of Androgen-Independent Prostate Cancer: Pharmacokinetic Enhancements Combined with Targeted Drug Delivery.

Authors - Theodoros Karampelas
humanWB

Free Radic Biol Med

Differentiation of SH-SY5Y cells to a neuronal phenotype changes cellular bioenergetics and the response to oxidative stress.

Authors - Schneider Lonnie L

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vignesh (Verified Customer) (09-19-2025)

The results are excellent, bands are clear

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HTR cells
Loading...
||
New chat Able
正在加载,请稍候...