COX4I2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COX4I2 Polyclonal antibody (11463-1-AP)

• Featured Product
• KD/KO Validated

COX4I2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11463-1-AP

Publications(22)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

COX IV 2, COX IV-2, COX4, COX4 2, COX4B

• Validation Data Gallery
• Proteintech vs. Other Vendors

• 

  WB analysis using 11463-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11463-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at 4 degree celsius over night.

• 

  WB analysis using 11463-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 11463-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11463-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11463-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11463-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 11463-1-AP

  IP result of anti-COX4I2 (IP:11463-1-AP, 3ug; Detection:11463-1-AP 1:1000) with HepG2 cells lysate 8000ug.

• 

  IP experiment using 11463-1-AP

  IP result of anti-COX4I2 (11463-1-AP for IP and Detection) with HepG2 cell lysate.

• 

  IHC staining of human ovary tumor using 11463-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11463-1-AP (COX4I2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HeLa using 11463-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX4I2 antibody (11463-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of HepG2 using 11463-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COX4I2 antibody (11463-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

"COX4I2 Antibodies" Comparison

View side-by-side comparison of COX4I2 antibodies from other vendors to find the one that best suits your research needs.

Compare now

---

Tested Applications

• Positive WB detected in: HepG2 cells, A375 cells, human brain tissue, MCF-7 cells, mouse heart tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 15 publications below
• IHC: See 4 publications below
• IF: See 4 publications below

Product Information

11463-1-AP targets COX4I2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1987

  Product name: Recombinant human COX4I2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC057779

  Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

• Full Name: cytochrome c oxidase subunit IV isoform 2 (lung)
• Calculated Molecular Weight: 171 aa, 20 kDa
• Observed Molecular Weight: 17-18 kDa
• GenBank Accession Number: BC057779
• Gene Symbol: COX4I2
• Gene ID (NCBI): 84701
• RRID: AB_2085287
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KJ9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I2, also named as COX4L2 and COXIV-2, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COXIV(cytochrome c oxidase IV) has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. This antibody was generated against full length COX4I2 protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; Defective Mitochondrial Cardiolipin Remodeling Dampens HIF-1α Expression in Hypoxia.; Authors - Arpita Chowdhury
human	WB	Oncotarget; Nuclear-encoded cytochrome c oxidase subunit 4 regulates BMI1 expression and determines proliferative capacity of high-grade gliomas.; Authors - Claudia R Oliva ; KD Validated
mouse	IF	Sci Signal; Acute O2 sensing through HIF2α-dependent expression of atypical cytochrome oxidase subunits in arterial chemoreceptors.; Authors - Alejandro Moreno-Domínguez ; KO Validated
human	WB	Free Radic Biol Med; Cytochrome c oxidase mediates labile iron level and radioresistance in glioblastoma.; Authors - Md Yousuf Ali
human	WB	Bioconjug Chem; GnRH-Gemcitabine Conjugates for the Treatment of Androgen-Independent Prostate Cancer: Pharmacokinetic Enhancements Combined with Targeted Drug Delivery.; Authors - Theodoros Karampelas
human	WB	Free Radic Biol Med; Differentiation of SH-SY5Y cells to a neuronal phenotype changes cellular bioenergetics and the response to oxidative stress.; Authors - Schneider Lonnie L

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Vignesh (Verified Customer) (09-19-2025)

The results are excellent, bands are clear

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: HTR cells