CTHRC1 Polyclonal antibody

• 

  WB analysis using 16534-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16534-1-AP (CTHRC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A375 using 16534-1-AP

  IP result of anti-CTHRC1 (IP:16534-1-AP, 3ug; Detection:16534-1-AP 1:500) with A375 cells lysate 3600ug.

• 

  IF Staining of A375 using 16534-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A375 cells using CTHRC1 antibody (16534-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 16534-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CTHRC1 antibody (16534-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of A375 using 16534-1-AP

  1x10^6 A375 cells were intracellularly stained with 0.13 ug CTHRC1 Polyclonal antibody (16534-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.13 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

CTHRC1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 16534-1-AP

Publications(33)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

collagen triple helix repeat containing 1, Collagen triple helix repeat-containing protein 1, Protein NMTC1, UNQ762/PRO1550

---

Tested Applications

• Positive WB detected in: A375 cells, Jurkat cells, mouse lung tissue
• Positive IP detected in: A375 cells
• Positive IF/ICC detected in: A375 cells, HepG2 cells
• Positive FC (Intra) detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 20 publications below
• IHC: See 14 publications below
• IF: See 9 publications below
• CoIP: See 1 publications below

Product Information

16534-1-AP targets CTHRC1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9812

  Product name: Recombinant human CTHRC1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-243 aa of BC014245

  Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

• Full Name: collagen triple helix repeat containing 1
• Calculated Molecular Weight: 243 aa, 26 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC014245
• Gene Symbol: CTHRC1
• Gene ID (NCBI): 115908
• RRID: AB_2087511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CG8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Collagen triple helix repeat-containing protein 1 (CTHRC1), also known as protein NMTC1, is a glycosylated secreted protein. CTHRC1 was identified as a novel molecular in injured and diseased arteries where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration (PMID: 15618538). It has been reported that CTHRC1 is a positive regulator of osteoblastic bone formation (PMID: 18779865). Besides, studies reveal that CTHRC1 expression is implicated in various malignancies, including hepatocellular carcinoma, gastric carcinoma, colon cancer, and lung cancer (PMID: 23922981; 24504172; 24746208; 25139095).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Theranostics; Single-cell landscape reveals active cell subtypes and their interaction in the tumor microenvironment of gastric cancer.; Authors - Yumin Li
human	WB,IF	J Transl Med; Single-cell and spatial transcriptome profiling reveal CTHRC1+ fibroblasts promote EMT through WNT5A signaling in colorectal cancer; Authors - Yunfei Lu
human	WB,IF	Respir Res; Pirfenidone attenuates lung fibrotic fibroblast responses to transforming growth factor-β1.; Authors - Jin Jin
human	WB	Int J Mol Sci; Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.; Authors - Federica Morani
rat	WB,IHC	J Cell Sci; miR-9 inhibits Schwann cell migration by targeting CTHRC1 following sciatic nerve injury.; Authors - Songlin Zhou ; KD Validated
human,mouse	WB,IF	Inflammation; Collagen Triple Helix Repeat Containing 1 Deficiency Protects Against Airway Remodeling and Inflammation in Asthma Models In Vivo and In Vitro; Authors - Yong Feng ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Swati (Verified Customer) (09-26-2025)

The antibody shows a clear band at 28/30 kDa in WB with no background. Excellent.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000 (for WB)
• Cell Tissue Type: Human/murine lung fibroblasts

CTHRC1 Antibody Western Blot validation (1:1000 (for WB) dilution) in Human/murine lung fibroblasts (Cat no:16534-1-AP)

FH

Valeria (Verified Customer) (11-11-2020)

Fixative: 4% paraformaldehydeAntigen retrieval step: NoPermeabilization: Methanol gradient (70% for 10 mins, 95% for 10 mins, 100% for 20 mins, 95% for 10 mins, 70% for 10 mins)Protein blocking: 10% NGS diluted in TBSTEndogenous biotin blocking: Avidin D solution for 15 mins, Biotin for 15 mins (Vector Laboratories, Inc)Secondary antibody: Life tech/ThermoFisher, A11006, Alexa 488, Goat anti-Rabbit isotype IgG, 1:100

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: Human skeletal muscle sections (10um)

CTHRC1 Antibody Immunofluorescence validation (1:200 dilution) in Human skeletal muscle sections (10um) (Cat no:16534-1-AP)