Tested Applications
| Positive WB detected in | mouse uterus tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12831-1-AP targets Alpha E-Catenin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3565 Product name: Recombinant human CTNNA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 188-536 aa of BC031262 Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI Predict reactive species |
| Full Name | catenin (cadherin-associated protein), alpha 1, 102kDa |
| Calculated Molecular Weight | 906 aa, 100 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC031262 |
| Gene Symbol | Alpha E-Catenin |
| Gene ID (NCBI) | 1495 |
| RRID | AB_2087822 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35221 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| IHC protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| IP protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| WB protocol for Alpha E-Catenin antibody 12831-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Alpha E-Catenin Polyclonal antibody (Cat# 12831-1-AP) has 33 citations published in journals including Oncogene, EMBO Reports, Genome Biology, Cell Death Discovery, PLoS Biology, eLife, Acta Pharmaceutica Sinica B, and Scientific Reports. Research fields span cancer biology (gastric, pancreatic, ovarian, colorectal, melanoma, nasopharyngeal, and lung cancers), epithelial-mesenchymal transition, cell adhesion and adherens junctions, Wnt signaling, inflammation, tissue repair, stem cell biology, and metabolic disorders. Applications include WB, IF, IHC, and IP.
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B Reversibly unlocking the blood-brain barrier: A study on microtubule dynamics modulation using gold nanoparticle-modified reduced graphene oxide. | ||
Int J Biol Sci Human CPTP promotes growth and metastasis via sphingolipid metabolite ceramide and PI4KA/AKT signaling in pancreatic cancer cells | ||
Cell Death Discov Upregulation of CPNE7 in mesenchymal stromal cells promotes oral squamous cell carcinoma metastasis through the NF-κB pathway. | ||
Genome Biol Ubiquitination degradation of GATA4 by CUL4B promotes ovarian cancer metastasis by inducing lysosomal acidification. | ||
Oncogene Transducin (β)-like 1 X-linked receptor 1 promotes gastric cancer progression via the ERK1/2 pathway. | ||
Oncogene The reciprocal interaction between tumor cells and activated fibroblasts mediated by TNF-α/IL-33/ST2L signaling promotes gastric cancer metastasis. |
