Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, SH-SY5Y cells, NIH/3T3 cells, Neuro cells, PC-12 cells, mouse testis tissue, rat testis tissue, mouse brain tissue |
| Positive IP detected in | mouse testis tissue, HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11107-1-AP targets CUL3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1555 Product name: Recombinant human CUL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 469-768 aa of BC039598 Sequence: KLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA Predict reactive species |
| Full Name | cullin 3 |
| Calculated Molecular Weight | 89 kDa |
| Observed Molecular Weight | 80-89 kDa |
| GenBank Accession Number | BC039598 |
| Gene Symbol | CUL3 |
| Gene ID (NCBI) | 8452 |
| RRID | AB_2086429 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13618 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ligase are the largest family of ubiquitin ligases which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. One of seven cullin proteins serves as a scaffold protein for the assembly of the multisubunit ubiquitin ligase complex. CUL3 (Cullin-3) ubiquitin ligase complex targets multiple substrate for ubiquitination including cyclin E and of cyclin D1. Defects in CUL3 are the cause of Pseudohypoaldosteronism type 2E (PHA2E) characterized by severe hypertension, hyperkalemia, hyperchloremia, hyperchloremic metabolic acidosis, and correction of physiologic abnormalities by thiazide diuretics.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CUL3 antibody 11107-1-AP | Download protocol |
| IHC protocol for CUL3 antibody 11107-1-AP | Download protocol |
| IP protocol for CUL3 antibody 11107-1-AP | Download protocol |
| WB protocol for CUL3 antibody 11107-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CUL3 Polyclonal antibody (Cat# 11107-1-AP) has 30 citations. These appear in journals including Nature Communications, Nucleic Acids Research, Advanced Science, Cell Death & Differentiation, Cell Death & Disease, Oncogene, Free Radical Biology and Medicine, Cell Reports, JCI Insight, FEBS Journal, Journal of Virology, and Food Chemistry. Research fields span ubiquitination and protein degradation (KEAP1/NRF2, CUL3-mediated pathways), cancer biology (NSCLC, hepatocellular, bladder, oral, ovarian, nasopharyngeal cancers), oxidative stress and antioxidant signaling, transcription regulation, and viral replication.
| Species | Application | Title |
|---|---|---|
Nat Commun RHOA regulates mitochondria-ER contact sites through modulation of the VAPB/PTPIP51 tether. | ||
Nucleic Acids Res K63-linked ubiquitylation of S2P-RNAPII regulates transcription in a DNAPK inter-dependent manner in response to double-strand breaks. | ||
Adv Sci (Weinh) DDRGK1 Enhances Osteosarcoma Chemoresistance via Inhibiting KEAP1-Mediated NRF2 Ubiquitination | ||
Cell Death Differ The kinase CK1α coordinates the initiation and termination of the cGAS-STING pathway. | ||
Cell Death Dis KEAP1 promotes anti-tumor immunity by inhibiting PD-L1 expression in NSCLC | ||
Food Chem Tangeretin maintains antioxidant activity by reducing CUL3 mediated NRF2 ubiquitination. |
Reviews
What customers say
Customers report generally positive results with this antibody for Western blot. One user at a 1:500 dilution observed clear, specific bands with good sensitivity in 293T cells. Another user at 1:1000 in HK-2 cells noted multiple bands, though all followed a consistent pattern, and identified the expected ~75 kD band as the target. Overall, the antibody is considered reliable for WB applications, with minor variability in band specificity depending on sample type and conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rajni (Verified Customer) (06-06-2025) | The Cul3 antibody performed well, producing clear and specific bands in Western blot. It demonstrated good sensitivity and target specificity under our experimental conditions.
|
Brittney (Verified Customer) (11-26-2018) | 10ug load of protein. Cells lysed in RIPA buffer then added to 2X Laemmli buffer for denaturing. Heated at 95deg for 10 minutes as well.Multiple bands, but all follow same pattern. Assumed the band at ~75 kD was the correct one.
|
