• Featured Product
  • KD/KO Validated

CUL7 Polyclonal antibody

CUL7 Polyclonal Antibody for WB, ELISA

Cat No. 13738-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

CUL 7, CUL7, cullin 7, KIAA0076

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13738-1-AP targets CUL7 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4675

Product name: Recombinant human CUL7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1348-1698 aa of BC033647

Sequence: GKEHKSEKEEEAGAAAVVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYLNDLKAVSVESLLAFSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRSRWDIVRLIPPQTYLQAEGEDGQNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTATQSFSTFR

Predict reactive species
Full Name cullin 7
Calculated Molecular Weight 1698 aa, 191 kDa
Observed Molecular Weight 185 kDa
GenBank Accession NumberBC033647
Gene Symbol CUL7
Gene ID (NCBI) 9820
RRIDAB_10640531
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14999
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The cullin family proteins are scaffold proteins for the Ring finger type E3 ligases, participating in the proteolysis through the ubiquitin-proteasome pathway. Humans express seven cullin proeins: CUL1-3, CUL4A, CUL4B, CUL5, and CUL7. Each cullin protein can form an E3 ligase similar to the prototype Ring-type E3 ligase Skp1-CUL1-F-box complex. The Cullin-RING-finger type E3 ligases are important regulators in early embryonic development, as highlighted by genetic studies demonstrating that knock-out of CUL1, CUL3, or CUL4A in mice results in early embryonic lethality. CUL7 was originally discovered as 185-kDa protein associated with the large T antigen of simian virus 40 (SV40). CUL7-deficient mice exhibit neonatal lethality with reduced size and vascular defects. CUL7 presumably plays a role in the DNA damage response by limiting p53 activity. CUL7 mutations have also been identified in 3-Msyndrome and the Yakuts short stature syndrome, both of which are characterized by pre- and post-natal growth retardation but with relatively normal mental and endocrine functions, suggesting that CUL7 may also be crucial for human placental development.

Protocols

Product Specific Protocols
WB protocol for CUL7 antibody 13738-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Diabetes

Liver kinase b1 is required for white adipose tissue growth and differentiation.

Authors - Zhang Wencheng W
humanWB

J Cell Sci

Cullin-3-KCTD10-mediated CEP97 degradation promotes primary cilium formation.

Authors - Tomoaki Nagai
  • KD Validated
ratWB

Am J Physiol Renal Physiol

Ubiquitination of NKCC2 by the Cullin-RING E3 Ubiquitin Ligase Family in the Rat Thick Ascending Limb of the Loop of Henle

Authors - Gustavo R Ares
humanWB

Adv Sci (Weinh)

Targeting Methylglyoxal Metabolism to Enhance Ferroptosis Sensitivity in Tumor Therapy

Authors - Xinyue Zhang
  • KO Validated
Loading...